Words Containing: A,K,L,L
(In Any Order)
There are 672 words,
984 phrases and
0 abbr's with
A,K,L,L in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
blackly | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
flakily | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
blankly | 7 | 16 | adverbadv | |||||
adverb • in a blank and uncomprehending manner | ||||||||
slackly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a relaxed manner; not rigid | ||||||||
bleakly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • without hope | ||||||||
alkylic | 7 | 16 | adjectiveadj | |||||
adjective • of or related to an alkyl | ||||||||
balkily | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
pollack | 7 | 15 | verb, nounv, n | |||||
noun • lean white flesh of North Atlantic fish; similar to codfish • United States filmmaker (born in 1934) • important food and game fish of northern seas (especially the northern Atlantic); related to cod | ||||||||
lawlike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
leakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
alkylWords (101)
ballparkhallmarklikeablecallbackbankrollroadkillfullbackladylikeskeletalfallbackalkalinekickballlakelandfolktalealkaloidskullcaplacklandballcockalkalizeshellackclawlikebackfillrockfallrollbackpullbackkeelhaulleaflikealkalisebalklinerakehelllacelikekillablelavalikeleaklesslakelike
...View all with 8 letters...
Phrases (19)
paul kleefall backark shellsick callball hawkblack flybulk mailreal talkpull backfolk tale
...View all with 8 letters...
Words (153)
blackmailblackpoolblackliststickballsleepwalkcatskillsunlikableblackballalkalosisbalalaikablacktailbuckyballalkalizershellbarkbladelikelampblackleafstalkmaplelikehallmarkswakefullywhalelikeadultlikealkaloticballparksclickablebankrollsblacklegsgablelikeflamelikesnaillikebackfillsalkalizedbreakwallkallidinsrakehelly
...View all with 9 letters...
Phrases (42)
little auktank shellbulk largeblack bilechalk talkblack flagtable talksilk glandwall clocklake ilmen
...View all with 9 letters...
Words (122)
basketballthankfullypainkillerrockabillylandlockedlacklusterunlikeablelacklustrealkalinizelawyerlikelikabilityunladylikealkalinitylukewarmlyhallmarkedunslakableultraslickbankrolledbankrollerblacklistsblackmailsskeletallyalkalizingjackrolledalkylatingshellackedshellbacksshellbarksbuckyballsleafstalksdislikablesalesclerkblackballsbullsnakesquillbacks
...View all with 10 letters...
Phrases (54)
alarm clockalkyl grouppalm kernelfolk balladlady killermusket ballblank shellgrace kellyblack whalelake ladoga
...View all with 10 letters...
Words (107)
blackmailersleepwalkerfloorwalkerrealpolitikskepticallyknuckleballshellackingkilocalorietalkativelyrathskellerlacklustersblackballedbankrollersbankrollinglikablenessblacklisteddislikeableblackmailedalkalimeterbackfillingalkylationsblanketlikepainkillinghallmarkingalkalimetryleukoplakialeukoplakicleukorrhealnonskeletalblacklisterbladderlikekilopascalssalesclerksantalkalieskeelhauling
...View all with 11 letters...
Phrases (66)
louis leakeynikola teslaflower stalkalkali metallike royaltybluish blackshell jacketalkyl halideballad makerbank swallow
...View all with 11 letters...
Words (77)
sleepwalkingjacksonvilleendoskeletalknowledgableblackballingkilocalorieslikabilitiesblacklistingblackmailingsleepwalkersalkalinitiesgalligaskinsshellackingsbackpedalledcytoskeletalrealpolitiksrathskellersknuckleballsblackguardlyleukoplakiasfloorwalkersblacklistersblackmailersalkalimetersalkalinizingkaryologicalrockabillieschuckawallasthankfullestshellcrackersk-ampicillinyellow-markedgallsicknessballbreakersunsailorlike
...View all with 12 letters...
Phrases (60)
looking glassalkyl radicallurking placealben barkleypull up stakeswilliam blakewilliam clarksparkle metalyellow jacketalice b. toklas
...View all with 12 letters...
Words (34)
knowledgeablekapellmeistergentlemanlikelackadaisicalchameleonlikeknowledgeablyporcelainlikelikablenessesblanketflowerknuckleballeralkalimetrieskinematicallyshellcrackersbackpedallinghaliplanktonsrealpolitikerblackballingsclickety-clackblockheadedlyunscholarlikeholoplanktonsblacklistingsfrankliniellaalkalescencesankyloglossiasleepwalkingsbalderlocksesslockdolagersmallemarokingpurplish-blacktalkabilitieskatabolicallyprickly-leafedprickly-leavedPhrases (64)
skeletal framejekyll and hydealkaline metalalaska fur sealalexander blokritual killingroller skatingaxial skeletontakakkaw fallsalfred kastler
...View all with 13 letters...
Words (17)
kapellmeisterskaryotypicallyknuckleballersacknowledgedlyalkalinizationblanketflowersgallsicknessesrealpolitikersblackberry-lilykilovolt-amperealkaline-lovinglikeablenessesalkalescenciesalkalinisationladylikenessespoikilothermalmallemarokingsPhrases (79)
small livestockskeletal systemhong kong dollarkwajalein atollblackwall hitchskilled workmanshark repellentartificial lakewilliam crookesslovak language
...View all with 14 letters...
Words (16)
lackadaisicallykinestheticallymusculoskeletalunknowledgeabletelekineticallyalkalinizationskaleidoscopicalknowledgabilitykenogeneticallyacknowledgeablylymphoblast-likemetallic-lookingacknowledgeableungentlemanlikealkalinisationsgranville-barkerPhrases (89)
kalaallit nunaatcontract killingin all likelihooderlenmeyer flaskwholesale marketalaskan malamutetragulus kanchilbokmaal languagekhalkha languagealbizzia lebbeck
...View all with 15 letters...
Words (4)
knowledgeablenesskaleidoscopicallyleukoencephalitisgentlemanlikenessPhrases (70)
william stricklandkiswahili languagelooking-glass plantswallow-tailed kiteblackfoot languagecapital of oklahomacatskill mountainscapital of slovakiarudolf karl virchowcapital of sri lanka
...View all with 17 letters...
Words (1)
alkylbenzenesulfonatePhrases (43)
aleksandr solzhenitsynbillie jean moffitt kingstephen william hawkingsmallmouthed black bassklebs-loeffler bacillusisle royal national parkthomas kennerly wolfe jr.battle of lake trasimenewilliam schwenk gilberterik alfred leslie satie
...View all with 21 letters...
Phrases (16)
louis seymour bazett leakeyrichard buckminster fullerequus caballus przewalskiimax karl ernst ludwig planckblack and gold garden spiderbattledore and shuttlecocknickel-cadmium accumulatorwireless local area networkequus caballus przevalskiihuman t-cell leukemia virus-1
...View all with 24 letters...
Phrases (12)
rudolf christian karl dieseltrans-alaska pipeline systembronislaw kasper malinowskimikhail yurievich lermontovislamic republic of pakistanvirgin islands national parkchronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellbruckenthalia spiculifolia
...View all with 25 letters...
Phrases (16)
charlotte anna perkins gilmanchannel islands national parksir sarvepalli radhakrishnanlassen volcanic national parkkarl rudolf gerd von rundstedtemployee stock ownership planmikhail ilarionovich kutuzovcockcroft-walton acceleratorchristoph willibald von gluckalexander alexandrovich blok
...View all with 26 letters...
Phrases (19)
director-stockholder relationjerusalem artichoke sunflowersir frederick william herschelaleksandr aleksandrovich blokfalkland islands monetary unitnikolai ivanovich lobachevskyuniversity of nebraska-lincolnwrangell-st. elias national parkhawai'i volcanoes national parkhawaii volcanoes national park
...View all with 27 letters...
Phrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay