Words Containing: A,K,I,Y,A
(In Any Order)
There are 104 words,
315 phrases and
0 abbr's with
A,K,I,Y,A in.
Best Scoring Words With: A,K,I,Y,A
| Expand? | Word | Save? | Length | Usage | Points | Type | |
|---|---|---|---|---|---|---|---|
We couldn't find any valid Scrabble US words with a maximum length of 7. Try increasing the max length or changing the version of the game.
Tip: Scrabble EU allows far more words than US! | |||||||
Words (1)
yakimaWords (21)
unmistakablystanislavskyhyperkalemiaholidaymakerpaddywackingdaydreamlikehypokalemiastracklayingskaryologicalgallygaskinsbradykinesiakyanisationskyanizationsblackish-graystravinskyangrayish-blackkakistocracykaryoplasmicbreakabilitykaryotypicalkeratohyalinPhrases (13)
shaking palsyalkyl radicalplay a trick onyangtze kiangbirthday cakemilitary rankhideki yukawaliterary hacksalt lake cityoklahoma city
...View all with 12 letters...
Words (10)
painstakinglymarketabilityholidaymakerskinematicallybradykinesiasjawbreakinglyremarkabilityunmistakeablyankyloglossiakatabolicallyPhrases (11)
el iskandriyahcocktail partyrichard leakeyanxiety attackrocky marcianoboykinia elatapiano keyboardst patrick's daycanyon live oakcoast boykinia
...View all with 13 letters...
Words (7)
karyotypicallybreathtakinglyearthshakinglymegakaryocyticyekaterinoslavkinematographybrachypinakoidPhrases (26)
capital of kenyadynamic speakerfamily akeridaegikuyu languageearly wake-robinwaslaw nijinskyhydraulic brakelake tanganyikablackfoot daisyyardbird parker
...View all with 14 letters...
Phrases (11)
louis seymour bazett leakeyandrei andreyevich gromykoaleksey maximovich peshkovpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneyayatollah ruholla khomeinidavid lewelyn wark griffithassyrian akkadian languageacute lymphocytic leukemia
...View all with 24 letters...
Phrases (1)
aleksandr feodorovich kerenskyPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
