Words Containing: A,K,E,Y,S
(In Any Order)
There are 259 words,
425 phrases and
0 abbr's with
A,K,E,Y,S in.
Best Scoring Words With: A,K,E,Y,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| keyways | 7 | 20 | nounn | |||||
noun • A slot into which a precision attachment (a key) is fitted. | ||||||||
| hawkeys | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| yakkers | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| keypads | 7 | 17 | nounn | |||||
noun • a keyboard that is a data input device for computers; arrangement of keys is modelled after the typewriter keyboard | ||||||||
| passkey | 7 | 16 | nounn | |||||
noun • key that secures entrance everywhere | ||||||||
| screaky | 7 | 16 | adjectiveadj | |||||
adjective satellite • having a rasping or grating sound • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| lackeys | 7 | 16 | nounn | |||||
noun • a male servant (especially a footman) • a person who tries to please someone in order to gain a personal advantage | ||||||||
| keypals | 7 | 16 | nounn | |||||
noun • The e-mail equivalent of a penpal; someone with whom to exchange e-mail for the simple joy of communicating. | ||||||||
| darkeys | 7 | 15 | ||||||
noun • (ethnic slur) offensive term for Black people | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (52)
speakeasykeynesianpaycheckskaffiyehsskyjackedskylarkerwalkyriesteriyakisankylosedkeffiyahsrockabyesyarmelkesyarmulkeskaleyardskeyboardsweakishlylatchkeysstreakilymalarkeysdaybreaksyearbooksskyjackerskylarkedyeastliketakeawaysyokemateseyeblacksankylosespalsylikehaymakersvalkyrieskaryosomesqueakilyalkylateseyestalks
...View all with 9 letters...
Phrases (13)
lake nyasasay hey kidguy fawkesstrike paysnake eyesgrey skatesneak awayyeast cakelyre snaketipsy cake
...View all with 9 letters...
Words (42)
mistakenlyskyscraperfreakishlydyskinesiagraywackesskylarkerssneakinglyskeletallyjackasserymythmakersplaymakersjonnycakesskyjackersswaybackeddayworkersjayhawkersjaywalkersbreakawayskaryosomeskaryotypeseukaryoteswykehamistchromakeysgreywackesstaymakersstickybeaksnakeberryhackneyismsneakishlykyphosidaespeakinglybreaksawaynosy-parkerstrokeplaycopytakers
...View all with 10 letters...
Phrases (13)
genus khayatake it easysafety lockoxygen maskoyster bankoyster parkalkyd resinkeyhole sawstroke playkhyber pass
...View all with 10 letters...
Words (42)
unspeakablykeyboardistskepticallyyastrzemskiskyscrapersprokaryotesbricklayerskaryogamiesmoneymakersdyskinesiasrekeyboardsmerrymakerstracklayerskaryologiesjohnnycakesyouthquakesthanklesslykeyboarderschelyabinskspiny-backedstickybeakshackneyismssnakeblennyarkansawyernosey-parkeryellowbacksyellowbarksyellowcakesmistakeablykosteletzyatracklesslysqueakinglyunshakeablybialystokersparklessly
...View all with 11 letters...
Phrases (17)
louis leakeyglossy snakemackerel skywhiskey neathockey skatethorny skatebrass monkeyhans eysencksubway tokenjack dempsey
...View all with 11 letters...
Words (26)
moneymakingshyperkinesiamerrymakingskeyboardistscytoskeletalhypermarketskymographieshypokalemiaskaryokineseskaryokinesiskeratoplastykeyboardingsbradykinesiastickybeakedblackish-greygreyish-blackkeynesianismkeratophyresalkalescencyladylikenesssparkleberrypancake-stylechimneystackcycloalkaneskidney-shapedyurak-samoyedPhrases (22)
backspace keybuckeye statedomesday bookalfred kinseyhawkeye statebackup systemdenmark veseyhockey seasonkey signatureshock therapy
...View all with 12 letters...
Words (17)
holidaymakershyperkinesiasheterokaryonshydrocrackersbradykinesiasstickybeakingfairnyticklesklyuchevskayadostoyevskianunmistakeablykenyapithecussketchabilityostyak-samoyedkinesitherapykeratomycosispsychometrikashockumentaryPhrases (31)
el iskandriyahthree kings' daychesapeake baybanking systemsilky wisteriatank destroyergenus kennedyagenus boykiniasnake polypodytreasury stock
...View all with 13 letters...
Words (12)
phytoplanktersankylosauruseshyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosiscantankerouslymegakaryocytesblackberryingsyekaterinoslavladylikenessesPhrases (30)
blackberry bushskeletal systemdynamic speakerkeynote addressstrawberry markblack raspberryostyak languagestanley kubrickrockrose familyblack-eyed susan
...View all with 14 letters...
Words (1)
alkylbenzenesulfonatePhrases (22)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitthomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemkurdistan workers partykurdistan workers' party
...View all with 21 letters...
Phrases (12)
francis scott key fitzgeraldtrans-alaska pipeline systemandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovchamaecyparis nootkatensisfederal home loan bank systemhenry kenneth alfred russellcommunist party of kampuchea
...View all with 25 letters...
Phrases (10)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolneysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
