Words Containing: A,K,E,R,Y
(In Any Order)
There are 295 words,
555 phrases and
0 abbr's with
A,K,E,R,Y in.
Best Scoring Words With: A,K,E,R,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
kayaker | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
yakkers | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
keycard | 7 | 17 | nounn | |||||
noun • a plastic card that has a magnetically coded strip that is scanned in order to operate a mechanism | ||||||||
knavery | 7 | 17 | nounn | |||||
noun • lack of honesty; acts of lying or cheating or stealing | ||||||||
kerygma | 7 | 17 | nounn | |||||
noun • preaching the gospel of Christ in the manner of the early church | ||||||||
yakker | 6 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
freaky | 6 | 16 | adverb, adjectiveadv, adj | |||||
adjective satellite • strange and somewhat frightening • conspicuously or grossly unconventional or unusual | ||||||||
fakery | 6 | 16 | nounn | |||||
noun • the act of faking (or the product of faking) | ||||||||
screaky | 7 | 16 | adjectiveadj | |||||
adjective satellite • having a rasping or grating sound • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
rackety | 7 | 16 | adjectiveadj | |||||
adjective satellite • uncontrollably noisy | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (33)
keyboardyearbookdaybreakmalarkeyyarmulkevalkyrieteriyakimarkedlyquackeryhaymakerfreakilyrockabyekaleyardbasketrykeycardsflackerykayakersyarmelkeknackerybankerlycreakilywalkyriekerygmasracketryflymakergreybackrokelayskerbayasfreakeryakaryoteeukaryoneukaryotdark-greyPhrases (6)
easy markmajor keykorea baycape yorkrye vodkalake eyreWords (55)
reykjavikbreakawayjaywalkerplaymakerthackerayjayhawkerkaryotypehackberryeukaryotefairylikeperikaryaskylarkerwalkyriesteriyakismythmakerkerygmatarockabyesyarmelkesyarmulkeskaleyardsrakehellykeyboardsgraywackestreakilymalarkeysdaybreaksyearbooksharpylikeskyjackerdayworkerskylarkedhaymakersvalkyriesmakereadykaryosome
...View all with 9 letters...
Phrases (16)
like crazykeep relaybreak awaymarket daylayer cakeyak buttermyrtle oakstrike paygrey skateturkey oak
...View all with 9 letters...
Words (60)
remarkablyblackberryskyscraperbricklayermoneymakerfreakishlyeukaryoticlawyerlikeprayerbookmerrymakerlukewarmlygraywackesskylarkersjackasserymythmakerskerygmatickeyboardedplaymakersrekeyboardperikaryalperikaryonskyjackersdayworkersjayhawkersjaywalkersprokaryotebreakawaysgadzookerykaryosomeskaryotypedkaryotypestracklayereukaryoteskeyboarderkeratotomy
...View all with 10 letters...
Phrases (28)
mary leakeyprayer booktalk turkeyyard markerkey patternlady killergray marketnew york baygrace kellybreak of day
...View all with 10 letters...
Words (36)
hypermarketjabberwockykeyboardistmerrymakingyastrzemskiskyscrapersprokaryotesbricklayerskaryogamieskeyboardingmoneymakersrekeyboardsgimcrackeryalkalimetryfactorylikemerrymakerstracklayerskaryologiesfarkleberrykeyboarderskleptocracyready-cookedcackleberrykeratectomyrheumatickykeratophyrearkansawyernosey-parkeryellowbarkstracklesslyarrhenotokybialystokersparklesslysilky-hairedparakeelyas
...View all with 11 letters...
Phrases (28)
like royaltypolicy makermackerel skyfunny remarkjourney cakethorny skatebrass monkeybicycle rackchicken yardparity check
...View all with 11 letters...
Words (32)
hyperkalemiaholidaymakerhyperkinesiaheterokaryonmerrymakingskaryokinetichydrocrackedkeyboardistsunremarkablyrekeyboardedhypermarketsdaydreamlikekymographieskaryokineseskaryokinesishydrocrackerkeratoplastykeyboardingsyellow-markedbradykinesiarevokabilityfairnyticklemockumentaryblackish-greygreyish-blackkeratophyressparkleberryhydraulickedcrackerberrybreakabilitykeratohyalinyurak-samoyedPhrases (34)
alben barkleyalfred kinseypatrick henryliterary workjewelry makerdavy crocketthockey playerdenmark veseykey signaturekeyboard tray
...View all with 12 letters...
Words (23)
marketabilityholidaymakersrekeyboardingmountebankeryphytoplankterhyperkinesiasheterokaryonsmegakaryocytekindheartedlyhydrocrackersbradykinesiasblackberryingfairnyticklesjawbreakinglyremarkabilityknickknackeryheartbrokenlykinesitherapyprickly-leafedprickly-leavedkeratomycosispsychometrikashockumentaryPhrases (39)
el iskandriyahturkey buzzardfactory workerdorothy parkerthree kings' dayrichard leakeyblack mulberrysilky wisteriatank destroyerkillarney fern
...View all with 13 letters...
Words (18)
hyperkeratoticphytoplanktersankylosaurusesbreathtakinglyhyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticmegakaryocyteshydrokineticalblackberry-lilyblackberryingsyekaterinoslavkinematographyPhrases (41)
emergency brakeblackberry bushdynamic speakerkeynote addressstrawberry markblack raspberryfamily akeridaestanley kubrickrockrose familyearly wake-robin
...View all with 14 letters...
Phrases (12)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykofrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneyayatollah ruholla khomeinidavid lewelyn wark griffithassyrian akkadian language
...View all with 24 letters...
Phrases (14)
francis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivermikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russell
...View all with 25 letters...
Phrases (11)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitmikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthday
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay