Words Containing: A,I,R,E,R
(In Any Order)
There are 7,971 words,
9,053 phrases and
0 abbr's with
A,I,R,E,R in.
Best Scoring Words With: A,I,R,E,R
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| bizarre | 7 | 18 | adjectiveadj | |||||
adjective satellite • conspicuously or grossly unconventional or unusual | ||||||||
| crazier | 7 | 18 | adjectiveadj | |||||
noun • someone deranged and possibly dangerous adjective satellite • affected with madness or insanity • foolish; totally unsound • possessed by inordinate excitement • bizarre or fantastic • intensely enthusiastic about or preoccupied with | ||||||||
| brazier | 7 | 18 | nounn | |||||
noun • large metal container in which coal or charcoal is burned; warms people who must stay outside for long times | ||||||||
| grazier | 7 | 17 | nounn | |||||
noun • a rancher who grazes cattle or sheep for market | ||||||||
| barkier | 7 | 13 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| brakier | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
| firearm | 7 | 12 | nounn | |||||
noun • a portable gun | ||||||||
| aircrew | 7 | 12 | nounn | |||||
noun • the crew of an aircraft | ||||||||
| charier | 7 | 12 | adjectiveadj | |||||
adjective • Careful, cautious, shy, wary. • Excessively particular or fussy about details; fastidious. • Not disposed to give freely; not lavish; frugal, sparing. • Cared for, regarded as precious; cherished. | ||||||||
| arrived | 7 | 11 | verbv | |||||
verb • reach a destination; arrive by movement or progress • succeed in a big way; get to the top | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
airerWords (146)
marriedarrivedearliercarriedtrailerbizarretrainerbarriercarrierterrainadmirerearringrefraincrazierprairiefirearmscarierpereirarivieraerraticcartierangrierrearingderridabrasiergarnierretrialbraziermarinerarmoirehairierarbiterretrainairfareharried
...View all with 7 letters...
Phrases (5)
air crewcar tirereal irahire carrice ratWords (341)
marriagecarriagelorraineliteraryairbornediarrheainfraredrestrainirritatecriteriaarteriesretainerarterialairlinerterrapinairforceanteriorirrigatereprisalretailerstrainergraingerairdromereaffirmgardinerpretoriatertiarypretrialquarriedfirmwarerarefiedfiretraprepairercineraryprogeria
...View all with 8 letters...
Phrases (25)
air coverwar crimeriver camj. m. barriepier archair forcekaw rivernan riverair powerhair care
...View all with 8 letters...
Words (585)
preparingregardinghurricanearrestingartilleryirritatedunmarrieddisregardremarriedirregularguerrillarestraintnarrativebarricaderewardinghierarchyremaindercartridgeitineraryregistrarirritablepartridgelibrariesorganizermargarinereprimanddiarrhoeariverbankbarristerrepairmanretrievalbrigadiercarnivoredisbarredliberator
...View all with 9 letters...
Phrases (63)
in arrearsmt. rainierair lettergrey friarhair drierrisk takerhair dryeramur riverbriar pipetrain fare
...View all with 9 letters...
Words (940)
literatureirrelevantrehearsingfraternityreassuringrecreationhereditarymargueritegrapefruitrainforestfundraisersilverwarerestrainedrhetoricalterminatorveterinaryperipheralprecarioustrilateralproverbialaberrationbarricadedquarrelingbricklayerringleaderringmastercaricaturesurrealismsurrealistrespiratortranspiredtraffickerpremaritalreciprocalgeriatrics
...View all with 10 letters...
Phrases (152)
air cleanertidal riverair currentbitter sparzaire riverstrike hardrewrite mancar carrierfor certainstrip alert
...View all with 10 letters...
Words (1234)
anniversaryappropriatereservationpreparationtemporarilypartnershiphairdresserpreliminarytransmitterinterrogateagriculturemercenariesrestorationcaterpillarmiscarriagerespiratoryreactionaryentertainerterritorialcrematoriumrespirationterrestrialarraignmentfirecrackerdeteriorateincorporategingerbreadhorseradishquarrellingproletariatprerogativeirreparablecorrelationpericardialstreamliner
...View all with 11 letters...
Phrases (301)
prairie wolfmeat grinderdrill masterdiego riveraspace writercastor fibersensory hairinvert sugarwinter breakbarrier reef
...View all with 11 letters...
Words (1236)
embarrassingregistrationrefrigeratorkindergartenarchitecturetransferringinterrogatedveterinarianincorporatedpreservationtranquilizerincarceratedcorrectionalhemorrhagingrecreationalbureaucraticregenerationdeterioratedhairdressinginterstellarpractitionerexterminatorintermediaryredecoratingimpersonatorperspirationracketeeringrepatriationrefrigeratedcharacterizefraternizingextramaritaldisregardingperipherallyredecoration
...View all with 12 letters...
Phrases (406)
measuring rodel libertadorgrain cleanervistula riversilver dollarmount rainierstar sapphirefrancis drakeparhelic ringsquirrel away
...View all with 12 letters...
Words (1090)
extraordinaryrevolutionaryinterrogationgrandchildreninappropriatecontroversialreincarnationmediterraneanarchitecturalinterrogatingirreplaceableheartbreakingappropriatelydeterioratingparliamentarydeteriorationcharacterizedincarcerationdefibrillatorpreliminariesprecautionaryrefrigerationproliferationparaphernaliadisintegratortransgressionhermaphroditeundercarriageirretrievablyexpropriationprocrastinateconservatoirediscretionaryorchestratinginterpersonal
...View all with 13 letters...
Phrases (565)
partial breachvaginal arterycartridge cliplarix sibericameasuring wormprunus persicagilbert murraygrain merchantfire insurancefrances wright
...View all with 13 letters...
Words (889)
representativeinterpretationrepresentationinfrastructurecharacteristicgroundbreakingcontemporariesextraordinaireinterplanetarytransformativereorganizationterritorialityscatterbrainedfraternizationwhippersnapperirreconcilableembarrassinglyintermediariesarrondissementtransistorisedunrefrigeratedosteoarthritisirreproachableantiperspirantreorganisationhermaphroditicspectrographictransmogrifiedautobiographerterritorialismintervertebralextravehiculardermatographicsuperpatrioticfeatherbrained
...View all with 14 letters...
Phrases (652)
imperative formimperative verbdirect contrastseriola grandisneutral spiritscircuit breakerjacques cartierarterial plaquemultiflora rosepartial verdict
...View all with 14 letters...
Words (664)
extraordinarilyrevolutionariescinematographerextracurricularentrepreneurialinappropriatelyuncontroversialappropriatenessgastroenteritisproportionatelycontroversiallyrecrystallizingcounterirritantunparliamentaryprestidigitatorjurisprudentialreapportionmentrecertificationrematerializingreconcentrationarchitecturallyparliamentarianinterrogatoriesreconsiderationmisappropriatedheartbreakinglyneuropsychiatryreauthorizationatherosclerosiscircumferentialparliamentarismreappropriatingoverdramatizinginterrogativelyperpendicularly
...View all with 15 letters...
Phrases (773)
malaria parasitedame muriel sparkfalco peregrinusseriola dorsalisjunction barrieroutside marriagestrait of georgiaalectoris graecasingapore dollaradvisory service
...View all with 15 letters...
Words (292)
extraterrestrialdisproportionateneurotransmitterundersecretariescharacterizationcountersignaturerepresentationaluncharacteristicreinterpretationnonrevolutionaryintraventricularinterpretationalerythroblastosisinterventricularsurrealisticallyarteriosclerosischaracterisationpredeterminationanthropomorphiseanthropomorphizenonproliferationneuropsychiatricnorthamptonshireexteriorizationsirrevocabilitiescivil-libertariancolorimetricallyradiochemistriesspectroheliogramexterritorialitythermometricallyparameterizationextracurricularspraiseworthinessrecurvirostridae
...View all with 16 letters...
Phrases (759)
czar alexander iiigenus utriculariaarteria vaginaliscartridge ejectorneritid gastropodcartridge removerproteles cristatalarrea tridentataaleksandr borodinnathaniel currier
...View all with 16 letters...
Words (208)
misinterpretationintergovernmentalmisrepresentationelectrocardiogramparathyroidectomycardiorespiratoryinappropriatenessinterrelationshipinterdisciplinaryinterdepartmentalantirevolutionaryhyperreactivitiesself-contradictorycountersignaturesradioautographiesirrevocablenessesspectroheliogramsspectroheliographcounterstrategiescounterstrategistparameterizationsprivate-enterpriseparaprofessionalsextraterrestrialsthermoregulationsmisrepresentativeradiotelegraphiescountertraditionsultraconservativecrashworthinessesnonproliferationschlortetracyclineappropriatenessesarchconservativesrecentralizations
...View all with 17 letters...
Phrases (824)
mary leontyne pricedirect correlationpontederia cordatacivil rights leaderacherontia atroposprivate instructorrepublic of armeniarepublic of austriarepublic of belaruspearly everlasting
...View all with 17 letters...
Words (131)
characteristicallydisproportionatelygastroenterologisthyperaldosteronismoverrepresentationexterritorialitiesspectroheliographscounterstrategistsmisinterpretationsspectroheliographymisrepresentationsarteriolosclerosisarchaeoastronomiesunrestrainednessesanthropocentricitynonrepresentativesrechromatographiesrechromatographingnonrevolutionariesastrophotographiesenterobacteriaceaelumpenproletariatsstereophotographicstereoregularitiespraiseworthinesseshyperbilirubinemiaperpendicularitiespteridospermaphytapteridospermopsidaterritorialisationtrichlormethiazideterritorializationrecrystallizationsmacrophotographiespredestinarianisms
...View all with 18 letters...
Phrases (819)
bombycilla cedrorunarteria vertebralisdouble-deck carriageprofessional golfererinaceus europaeusrevolutionary groupamerican revolutiondrafting instrumentprivate corporationeriobotrya japonica
...View all with 18 letters...
Words (96)
hyperparathyroidismhydrochlorothiazidepseudohermaphroditestraightforwardnesscountersurveillanceextraordinarinessesextraterritorialityparathyroidectomiesultracentrifugationstereophotographiesresorcinolphthaleinbacteriochlorophyllgastroenterologicalgastroenterologistsreindustrializationprefigurativenesseselectrocardiographsphonocardiographieselectrocorticogramsauriculoventriculardehydrochlorinatingdehydrochlorinationmercury-contaminatedneurofibromatosisessuperadministratorsneuropharmacologiesinterdepartmentallyneuropharmacologistcontradictorinessesrepresentationalismrepresentationalistelectrometallurgiesinterferometricallyhysterosalpingogramadrenocorticotropic
...View all with 19 letters...
Phrases (696)
measuring instrumentfavourable receptionerinaceus europeaeussierra madre orientalrejoicing over the lawtheodore harold whitecease and desist ordermicromeria douglasiizairese monetary unitbarren ground caribou
...View all with 19 letters...
Words (50)
counterrevolutionaryuncharacteristicallyhypercholesterolemiatetrahydrocannabinolparadichlorobenzenesspectroheliographiesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedunrepresentativenesshyperadrenocorticismcounterdemonstrationbacteriochlorophyllsreindustrializationspseudohermaphroditicdehydrochlorinationsadrenocorticosteroidadrenocorticotropinsneuropharmacologicalneuropharmacologistsrepresentationalismsrepresentationalistsneuropsychiatricallyhyperlipoproteinemiarepresentativenessesadrenocorticotrophicultracentrifugationsadrenocorticotrophinelectrooculographieselectrophotographiesanthropocentricitieselectroretinographicultrarevolutionariesmicrocrystallinities
...View all with 20 letters...
Phrases (597)
archeological remainsgilbert charles stuarthonduran monetary unitorder mycelia steriliaprofessional relationdwarf flowering almondpast progressive tenseorder myxobacterialeslunar excursion modulesir karl raimund popper
...View all with 20 letters...
Words (19)
extraterritorialitiesstereomicroscopicallystraightforwardnesseselectrocardiographiespseudohermaphroditismneuroendocrinologicaladrenocorticosteroidsadrenocorticotrophinsotorhinolaryngologieselectromyographicallydendrochronologicallyovercommercializationelectroretinographiesarenaria-melanocephalacounterdemonstrationsantiferromagneticallyhypercholesterolemiascounterinterpretationtetrahydrocannabinolsPhrases (503)
acrocentric chromosomesir john everett millaissierra madre occidentaladministrative hearingdissolution of marriagesierra nevada mountainsanaphalis margaritaceaanthriscus cereifoliumbureaucratic procedurehelichrysum bracteatum
...View all with 21 letters...
Words (6)
counterrevolutionariesspectrophotometricallyunrepresentativenessesnonrepresentationalismovercommercializationscounterinterpretationsPhrases (401)
administrative districtgregorian calendar monthprunus persica nectarinacoronavirus disease 2019posterior nasal apertureredevelopment authoritytrazodone hydrochloridebarbara wertheim tuchmansir laurence kerr olivieritalian vegetable marrow
...View all with 22 letters...
Words (3)
electroencephalographicnonrepresentationalismsdichlorodifluoromethanePhrases (303)
family threskiornithidaeparenthetical expressionposterior pituitary glandchlorpheniramine maleatearchibald percival wavellboeing b-52 stratofortressparis-sorbonne universityapium graveolens rapaceumstercorarius parasiticusbrassica oleracea italica
...View all with 23 letters...
Words (7)
microgramma-piloselloideslaryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyelectroencephalographiesmicroelectrophoreticallydichlorodifluoromethanesPhrases (254)
carnegie mellon universityprofessional organisationprofessional organizationlowland burrowing treefrogargyroxiphium sandwicensemary wollstonecraft godwinprivately held corporationcapture of fort ticonderogaprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (197)
united states secret servicecluster of differentiation 4myroxylon balsamum pereiraecosmic microwave backgroundmiguel de cervantes saavedradiamond wedding anniversarymusculus quadriceps femorisfrancis scott key fitzgeraldbrassica oleracea gemmiferatherapeutic rehabilitation
...View all with 25 letters...
Phrases (139)
charlotte anna perkins gilmanfrances eliza hodgson burnettshort-spurred fragrant orchidconfederate states of americasir sarvepalli radhakrishnanright atrioventricular valvebrassica oleracea gongylodesalternanthera philoxeroidescorrectional rehabilitationwar of the austrian succession
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (110)
partial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinelectromechanical transducernational labor relations boardaugustus welby northmore pugindirector-stockholder relation
...View all with 27 letters...
Phrases (93)
revolutionary people's struggleinterstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksdistinguishing characteristiccardiopulmonary resuscitationmicrosoft disk operating system
...View all with 28 letters...
Phrases (73)
business interruption insurancealeksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebeldisorganized type schizophreniadmitri dmitrievich shostakovichcombination in restraint of tradesouth-central dravidian language
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (49)
valentina vladmirovna tereshkovaself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedouble standard of sexual behaviorcoluber constrictor flaviventrisvicomte ferdinand marie de lessepsrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovuniversal gravitational constant
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (52)
great smoky mountains national parkbureau of intelligence and researchfreedom from involuntary servitudemarie louise elisabeth vigee-lebrun2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verditupac amaru revolutionary movementsir john frederick william herschelunited states trade representative
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (37)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (31)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagecongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming language
...View all with 33 letters...
Phrases (31)
jacques francois fromental elie halevyconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationgeorge louis palmella busson du mauriernero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreatici
...View all with 34 letters...
Phrases (23)
national technical information servicejohann christoph friedrich von schillertadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathy
...View all with 35 letters...
Phrases (20)
center for disease control and preventionrank-difference correlation coefficientangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanueltransportation security administration
...View all with 36 letters...
Phrases (19)
sisters of the order of saint basil the greattheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban development
...View all with 37 letters...
Phrases (9)
general certificate of secondary educationalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (13)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (11)
minnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance group
...View all with 40 letters...
Phrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (7)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousness
