Words Containing: A,I,L,N,P,T,Y
(In Any Order)
There are 722 words,
884 phrases and
0 abbr's with
A,I,L,N,P,T,Y in.
Best Scoring Words With: A,I,L,N,P,T,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
piquantly | 9 | 23 | adjectiveadj | |||||
adverb • with strong spices; in a spicy manner | ||||||||
flippantly | 10 | 20 | adverbadv | |||||
adverb • in a flippant manner | ||||||||
playthings | 10 | 19 | nounn | |||||
noun • an artifact designed to be played with | ||||||||
plaything | 9 | 18 | nounn | |||||
noun • an artifact designed to be played with | ||||||||
playacting | 10 | 18 | nounn | |||||
noun • the performance of a part or role in a drama | ||||||||
synoptical | 10 | 17 | adjectiveadj | |||||
adjective satellite • presenting or taking the same point of view; used especially with regard to the first three gospels of the New Testament | ||||||||
polyanthi | 9 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
nyctalopia | 10 | 17 | nounn | |||||
noun • inability to see clearly in dim light; due to a deficiency of vitamin A or to a retinal disorder | ||||||||
nontypical | 10 | 17 | adjectiveadj | |||||
adjective • Not typical | ||||||||
poignantly | 10 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a poignant or touching manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (26)
poignantlyplayactingflippantlysynopticalnuptialityoutplayingplaythingsinterplayspartisanlynyctalopiaponytailedoptionallynontypicalptyalisingptyalizingstaphylinepolyactinepatroclinytaperinglyhypanthialnyctalopicplanimetryanaglypticsynapticalpuissantlyplatyrhinePhrases (3)
ivory plantparty linertoy spanielWords (46)
personalityimportantlypotentiallypunctualityimpatientlyplaywritingrhinoplastyangioplastyplaintivelyinculpatoryplatyrrhinegenotypicaluntypicallyplacatinglyprattlinglyoptionalitysuppliantlycoplanaritystaphylinidinterplayedperinatallyphytoalexinantileprosyamylopectinacceptinglynyctalopiascompliantlytypicalnessbipinnatelytoponymicalplayactingsopenabilitypentaploidypolyactinalpatricianly
...View all with 11 letters...
Phrases (8)
stay in placetin pan alleypansy violetpanther lilypanty girdleplain turkeydipylon gateplant familyWords (87)
passionatelymunicipalityanaphylactictriumphantlyphilanthropyprincipalityindisputablyparalyzationphoneticallypotentialityplatonicallyhypnoticallylycanthropichypnotisableincapabilitypedanticallyunpopularityphenotypicalunprofitablyantimonopolypansexualityantiepilepsyinterplayinghypnotizableprudentiallyimpenetrablyprostacyclinpontificallyinhospitablyappetizinglydiscrepantlyplaywritingsstaphylinidsantiphonallyprintability
...View all with 12 letters...
Phrases (30)
phantasy lifeplantain lilyacrylic painttennis playerpetit larcenytenpenny nailplatonic bodyplay a trick onmalayan tapirspiny talinum
...View all with 12 letters...
Words (128)
exceptionallycomplimentaryparliamentarypredominantlyexponentiallypainstakinglydependabilitypredominatelysyphilizationunpunctualitycryptanalysisendolymphaticunpredictablyamitriptylinepenetratinglypusillanimityconceptualitypenetrabilityintemperatelypenitentiallyplatyhelminthplaywrightinghyperinflatedinsupportablylymphadenitisdeprecatinglyanaphylactoidcomplaisantlyinhospitalitygenotypicallypatentabilityimpersonalityparanormalitysempiternallyexpandability
...View all with 13 letters...
Phrases (11)
latency periodoriental poppysingletary peapenal facilitymilitary planerallying pointsaint polycarpsplenic arterypyramidal tentinstant replay
...View all with 13 letters...
Words (113)
interplanetaryhyperventilateproportionallypsychoanalyticexperimentallypolymerizationprovidentiallytelephonicallypreferentiallyunpalatabilitylyophilizationimpregnabilitypolybutadienescompensabilityunflappabilityunappetizinglypresentabilitydisappointedlysycophantishlyexceptionalityexasperatinglyantisepticallypleonasticallypertinaciouslyplatyhelminthsoccupationallypreventabilitynaphthylaminesplaywrightingshyperinflationanthophyllitesmanipulabilitymanipulativelyepigeneticallypresidentially
...View all with 14 letters...
Phrases (33)
pituitary glandcapital of kenyalife expectancylimited companymental capacityphysical entityitalian cypressgenus stypheliaitalian parsleyrecycling plant
...View all with 14 letters...
Words (122)
inappropriatelyincompatibilityparentheticallyplenipotentiarysuppositionallyproportionatelydisappointinglycompassionatelyuncomplimentarymethylphenidateunparliamentaryproportionalityunacceptabilityinspirationallydispassionatelycontemplativelycomplementarityimponderabilitysycophanticallyincomparabilityhypersalivationunemployabilityuncopyrightableinexplicabilityinapplicabilitycompositionallypolymerisationspolycrystallinehyperfunctionalproselytizationneuropathicallypyrotechnicallyphosphorylatingphosphorylationinterpersonally
...View all with 15 letters...
Phrases (47)
alimentary pastestonecrop familycapital of norwaybrittany spanielaplysia punctatapolitical entityegyptian capitalautophytic plantpersonality testcapillary action
...View all with 15 letters...
Words (67)
triphenylmethaneunpredictabilityhyperventilationpsychoanalyticalphylogeneticallyunapologeticallyhypersalivationsantistrophicallyspondylarthritisparamagneticallyhyperstimulatinghyperstimulationantiunemploymentpolysynapticallyhyperventilatingmonopolisticallymonosynapticallyhemoglobinopathyperpendicularitypostpositionallyindispensabilitylyginopteridalesstenographicallypostsynapticallystereophonicallylymphangiectasialymphangiectasisunrespectabilityonomatopoeicallyphenylethylaminephenylketonuriastransportabilityconspiratoriallyorganolepticallyundiplomatically
...View all with 16 letters...
Phrases (57)
strictly speakingcapital of hungaryin all probabilitycapital of new yorkpharyngeal tonsilfamily pythonidaeflat panel displayparalysis agitansmilitary chaplainprince albert's yew
...View all with 16 letters...
Words (49)
anthropologicallyphilanthropicallymultidisciplinaryinterdisciplinaryhyperstimulationshyperventilationshypnotizabilitiespaternalisticallymorphogeneticallycryptocrystallineencephalomyelitispostrevolutionarymicropaleontologytranscriptionallylymphadenopathieshyperalimentationtransdisciplinarythiodiphenylamineonomatopoeticallytransplantabilityphenylethylaminesnephelometricallyopportunisticallyptilonorhynchidaetriphenylmethanesjurisprudentiallyimpressionabilityunsympatheticallyimprovisationallycopolymerizationsretroperitoneallydephosphorylatingdephosphorylationdepolymerizationsphotomechanically
...View all with 17 letters...
Phrases (79)
mary leontyne pricehypoglycemic agentpearly everlastingsubphylum craniatacapital of kentuckycylinder separatortypha angustifoliacapital of marylandpython reticulatusdisability payment
...View all with 17 letters...
Words (20)
disproportionatelyhyperaldosteronismpolyesterificationlaryngopharyngitispostpsychoanalyticgranulocytopoiesesgranulocytopoiesisrepresentationallypropagandisticallydephosphorylationspsychoanalyticallyphotosyntheticallyhyperalimentationsphytohemagglutinindimethyltryptaminediphenylhydantoinshypernationalisticpolyacrylonitrileshyperpolarizationshyperrationalitiesPhrases (76)
revolutionary groupinfantile paralysiscapital of new jerseypolish monetary unitrespiratory illnessphoenix dactyliferaparliamentary agentelectronics companyamlodipine besylatemilitary expedition
...View all with 18 letters...
Words (20)
cinematographicallypolyesterificationshypolipoproteinemiaparthenogeneticallyconceptualisticallyphenomenalisticallyphenylthiocarbamidephosphatidylcholineinterdepartmentallyhysterosalpingogramimpressionisticallyanthropocentricallyanthropomorphicallyelectroretinographyencephalomyelitidesoverproportionatelyphytohemagglutininshyperemotionalitiesdimethyltryptaminesexpressionisticallyPhrases (82)
water-plantain familyalpine type of glacierphytolacca americanacapital of kyrgyzstansalicylate poisoningsymphytum officinalesubfamily mephitinaesubfamily potoroinaeolfactory perceptionphylum aschelminthes
...View all with 19 letters...
Words (10)
lymphogranulomatosisphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiahistoincompatibilityroentgenographicallyencephalomyocarditisphotophosphorylationPhrases (77)
marchantia polymorphadianthus caryophyllusfriendly relationshipamyloid protein plaquepolitically incorrectsupplementary benefitphylogenetic relationpersonality inventorypass with flying colorslateral epicondylitis
...View all with 20 letters...
Words (2)
photophosphorylationsclinicopathologicallyPhrases (73)
eucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaspectroscopic analysisphylum platyhelminthessuperfamily tyrannidaeorder lyginopteridalesperomyscus maniculatusfamily cyprinodontidaelycopodium complanatum
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (74)
redevelopment authorityfamily dendrocolaptidaemultiple mononeuropathyparliamentary proceduresamuel pierpoint langleydisplaying incompetencedepartment of philosophyfamily hippocastanaceaeinterpersonal chemistryphysical rehabilitation
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (48)
posterior pituitary glandyellowstone national parkcanyonlands national parktricyclic antidepressanteastern malayo-polynesiansir anthony philip hopkinsamerican federalist partywestern malayo-polynesianminister plenipotentiarybryce canyon national park
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaphosphatidylethanolaminePhrases (33)
privately held corporationexistentialist philosophyhaematoxylum campechianumanal retentive personalityoxidative phosphorylationelectroconvulsive therapyposterior meningeal arteryprofessional tennis playerperfectly inelastic demandantiphospholipid antibody
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (23)
trans-alaska pipeline systempyotr alexeyevich kropotkinconstant of proportionalitytympanuchus pallidicinctuscomplementary distributionsuperorder labyrinthodontapelvic inflammatory diseasepsettichthys melanostichusessential thrombocytopeniaindented cylinder separator
...View all with 25 letters...
Phrases (23)
employee stock ownership planentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authorityscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressantintermediate temporal arteryclosed-end investment companyparliamentary-cabinet system
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (16)
augustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteintopical prostaglandin eyedropreciprocal-inhibition therapyhypothalamic releasing factorisobutylphenyl propionic acid
...View all with 27 letters...
Phrases (13)
revolutionary people's strugglecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacepalestinian national authorityhypothalamic releasing hormonepan troglodytes schweinfurthiimethamphetamine hydrochloride
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (14)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating systemenvironmental protection agency
...View all with 29 letters...
Phrases (18)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (9)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economysubacute inclusion body encephalitisphysiological jaundice of the newborn