Words Containing: A,H,V
(In Any Order)
There are 1,205 words,
1,574 phrases and
0 abbr's with
A,H,V in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| mitzvah | 7 | 24 | nounn | |||||
noun • (Judaism) a precept or commandment of the Jewish law • (Judaism) a good deed performed out of religious duty | ||||||||
| mikvahs | 7 | 19 | nounn | |||||
noun • (Hebrew) a ritual purification and cleansing bath that Orthodox Jews take on certain occasions (as before Sabbath or after menstruation) | ||||||||
| anchovy | 7 | 18 | nounn | |||||
noun • tiny fishes usually canned or salted; used for hors d'oeuvres or as seasoning in sauces • small herring-like plankton-eating fishes often canned whole or as paste; abundant in tropical waters worldwide | ||||||||
| mikvah | 6 | 18 | nounn | |||||
noun • (Hebrew) a ritual purification and cleansing bath that Orthodox Jews take on certain occasions (as before Sabbath or after menstruation) | ||||||||
| knavish | 7 | 17 | adjectiveadj | |||||
adjective satellite • marked by skill in deception | ||||||||
| vampish | 7 | 17 | adjectiveadj | |||||
adjective • Like a vamp (flirtatious woman). | ||||||||
| heavily | 7 | 16 | adverbadv | |||||
adverb • to a considerable degree • in a heavy-footed manner • with great force • in a manner designed for heavy duty • slowly as if burdened by much weight • in a labored manner • indulging excessively | ||||||||
| behaved | 7 | 16 | adjectiveadj | |||||
verb • behave in a certain manner; show a certain behavior; conduct or comport oneself • behave in a certain manner • behave well or properly | ||||||||
| yeshiva | 7 | 16 | noun, adjectiven, adj | |||||
noun • an academy for the advanced study of Jewish texts (primarily the Talmud) | ||||||||
| wharves | 7 | 16 | nounn | |||||
noun • A man-made landing place for ships on a shore or river bank. • The bank of a river, or the shore of the sea. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (83)
achieveheavensheavilyharvestharvardbehavedshavingheaviermitzvaharchivejehovahvarnishhelluvaheavingvaughanyeshivahanoversheavesanchovyslavishheavieswharveskharkovknavishvampishhryvnashavenedsheavedupheavehalversheaversreshaveshaversshaviesevanish
...View all with 7 letters...
Phrases (7)
heave uple havrehave gotvan goghphase ivhave a gohave sexWords (132)
whateverbehaviorvanishedachievedheavenlyhangoveroverheadarchivessavannahhandoverheaviestchivalryupheavaloverhearadhesivevalhallaoverhaulvanquishoverheatachieverunshavenlavishlyoverhangverandahoverhandunshavedheavysethavelockarchivalshivareehannoverravishertovarishtovarichmalevich
...View all with 8 letters...
Phrases (14)
have downhand overhive awayarch overhand visehash overheat wavenew havenvitamin hhave a fit
...View all with 8 letters...
Words (167)
behaviouroverheardavalanchechevalierravishinghelveticaachievingnashvillevanishingmisbehavecavendishleviathangorbachevharvestervehicularshortwaveshavetailvarnishedheavinesstovarischoverheadsashevilleflashoveroverwatchhaversacktsarevichhardcoverchivalricarchivistvouchsafediaghilevslavishlyovermatchoverreachhandwoven
...View all with 9 letters...
Phrases (38)
tv channelguava bushheavy sparlove matchhave a lookhave wordsdavid humegive chasesilver ashshort wave
...View all with 9 letters...
Words (180)
whatsoeverbehavioralharvestingwavelengthmisbehavedoverheatedchauvinistaftershavechivalroushovercraftexhaustiveoverchargechauvinismovershadowhargreaveshanoverianhexavalentachievablearchitravevouchsafedclavichordvibraphonevanquisherevenhandedheavenwardchangeoveravouchmentinchoativelavishnessravishmentvinegarishharvestmanarchrivalsoverhauledvenography
...View all with 10 letters...
Phrases (54)
vapour bathheavy swellbas mitzvahrive gaucheche guevarajohn calvinhappy eventgenus avahisquash vinechange over
...View all with 10 letters...
Words (188)
achievementheavyweighttchaikovskyhyperactivemisbehavingmachiavellikalashnikovoverheatingbehaviouralbodhisattvaoverhearingbaryshnikovmisbehavioroverhangingoverachieverachmaninovbehaviorismvouchsafingravishinglybehavioristavalanchingslaveholderunvarnishedlevelheadedexhortativeoverharvestovermatchesearthmoversoverhaulingchangeoversvagabondishoverwatchedoverwatchesrevarnishedrevarnishes
...View all with 11 letters...
Phrases (91)
humphry davy's gravenhageweather vanehanding overdasht-e-kavirarthur evansheavy hitterfifth avenuevarying hareanton chekov
...View all with 11 letters...
Words (144)
thanksgivingapprehensivechauvinisticunvanquishedshostakovichczechoslovakmisbehaviourpsychoactivebehaviorallyexhaustivelyoverachieveroverreachingoveremphasisphotovoltaicstakhanoviteunachievablevillahermosaunchivalrousbehaviouristadhesivenesschivalrouslyvanquishableevenhandedlyheavenlinessoverharvestsovermatchingczarevitchesoverreachersoverwatchinglavishnessesrevarnishingslaveholdersvenographiesphotoengraveheavyhearted
...View all with 12 letters...
Phrases (82)
space vehiclehead coveringconcave shapeviolent deathweaver's hitchglove leatherjohn van vleckjohn vanbrughhome invasionivan the great
...View all with 12 letters...
Words (82)
authoritativehyperactivityunderachievermachiavellianphotoengravedvouchsafementvideographersovershadowinghypervigilantmantelshelvesthanksgivingsoverharvestedoverbleachingslaveholdingsslavishnessesphotoengraverphotoengravesoverbreathingphotovoltaicsclavichordistvideographiesleatherleaveshyperreactivenonbehavioralboddhisattvasunderachievedunderachievesphotogravuresoveremphasizephotonegativebehavioristicsuperachievernonchauvinistvibraharpistsoverslaughing
...View all with 13 letters...
Phrases (93)
harvey cushingmight-have-beenseventh heavenheavy hydrogenheavy particleservice chargenative sulphurjaroslav hasekcervus elaphusadhesive agent
...View all with 13 letters...
Words (57)
czechoslovakiahyperventilateunderachievingextravehicularoveremphasizedservomechanismrehabilitativephotoengravingheavyheartedlyadhesivenessesevenhandednessunderachieversunchivalrouslychivalrousnesshypervigilanceoveremphasizesexhaustivenessoverenthusiasmheavenlinessesoverharvestinghandkerchievesphotoengraversoverbreathingsvouchsafementsclavichordistsapprehensivelyvaporishnessesunchauvinisticnonachievementsuperachieversphotooxidativeinterbehaviorsexhaustivitiesunvanquishableclishmaclavers
...View all with 14 letters...
Phrases (117)
thoracic cavityanthony van dyckanthony vandykethrow overboardboehmeria niveaflight maneuvermale chauvinistvalet de chambrejohn von neumannshellac varnish
...View all with 14 letters...
Words (37)
czechoslovakianauthoritativelynonachievementslevelheadednessphotoengravingshyperaggressivehypersalivationservomechanismshypervigilancesoveremphasizingoverenthusiasmsphosphorylativeoverachievementoverorchestratehyperreactivityhyperactivitiesconservatorshiphyperventilatedhyperventilatesinterbehavioralmultiwavelengthoverhastinessesphotorefractivehypoventilationhypovitaminosisheavy-handednesscervicographiesservomechanicalpinkish-lavendermisapprehensivevapourishnessesunauthoritativeavalokiteshvaraoveremphasisingnonpsychoactive
...View all with 15 letters...
Phrases (125)
sir john vanbrighvictor-marie hugomerchant vesselspahlavi languageivan the terriblelymphatic vesselchromatic visionenglish civil warenglish lavendergustav kirchhoff
...View all with 15 letters...
Words (28)
hyperventilationoverenthusiasticunderachievementhypersalivationsmachiavellianismhyperventilatinghypervitaminosesarchconservativemerchant-venturerconservatorshipsheavyheartednessmechanoreceptiveoverachievementssuperheavyweightapprehensivenessthermogravimeterthermogravimetrychauvinisticallychivalrousnesseshypervitaminosischancellorsvilleoverorchestratedoverorchestratesantihypertensiveevenhandednessessedative-hypnoticexhaustivenesseshyperinnervationPhrases (107)
festival of lightsmechanical devicenevil shute norwayvictoria woodhullachromatic visioninchoative aspectmonongahela rivercancer of the livercichorium endiviaark of the covenant
...View all with 16 letters...
Words (15)
hyperreactivitieshyperventilationsarchconservativeslevelheadednessesauthoritativenesssuperheavyweightsbosnia-herzegovinathermogravimetricphotoreactivatingphotoreactivationoverorchestratingunderachievementsoversophisticatedantihypertensiveshyperinnervationsPhrases (122)
division bryophytasalvia leucophyllacivil rights leadererithacus svecicusavoirdupois weightjohn the evangelistearth-received timelubavitch movementanethum graveolensthird cranial nerve
...View all with 17 letters...
Words (4)
apprehensivenessesheavyheartednessesphotoreactivationshemidemisemiquaverPhrases (99)
heat of vaporisationdivision anthophytaheat of vaporizationrelaxation behaviorniccolo machiavellidmitri shostakovichrheims-douay versionthanksgiving cactusanton van leuwenhoekhealth care provider
...View all with 18 letters...
Words (4)
anarcho-collectivismauthoritativenessesphosphoenolpyruvatehemidemisemiquaversPhrases (91)
rejoicing over the lawcivil rights activisthandle with kid glovesdivision schizophytaavogadro's hypothesismechanical advantagevalentina tereshkovauniversity of chicagoheavier-than-air craftivan petrovich pavlov
...View all with 19 letters...
Words (2)
overenthusiasticallyphosphoenolpyruvatesPhrases (83)
division tracheophytaamphitheatrum flaviumdevice characteristicmilton snavely hersheyvena brachiocephalicahelladic civilizationhugo alvar henrik aaltovirgil garnett thomsonanton pavlovich chekovludwig mies van der rohe
...View all with 20 letters...
Words (1)
polyvinyl-formaldehydePhrases (67)
sir john everett millaisadministrative hearinghead and shoulders aboveigor ivanovich sikorskytelephone conversationchionanthus virginicusanton pavlovich chekhovarctostaphylos uva-ursiantonie van leeuwenhoekintravenous anesthetic
...View all with 21 letters...
Phrases (52)
pelham grenville wodehousedivision heterokontophytaprivately held corporationdmitri ivanovich mendeleevjohann gottfried von herdercomprehensive examinationhypersensitivity reactionandrei andreyevich gromykobattle of chancellorsvilleoxidative phosphorylation
...View all with 24 letters...
Words (1)
uvulopalatopharyngoplastyPhrases (36)
igor fyodorovich stravinskychemical weapons conventiondistinguished service medalboris leonidovich pasternakpyotr alexeyevich kropotkinbaron alexander von humboldtandrei arsenevich tarkovskycommand processing overheadnorthern baptist conventionaleksey maksimovich peshkov
...View all with 25 letters...
Phrases (27)
sir sarvepalli radhakrishnanright atrioventricular valveanton grigorevich rubinsteinhuman immunodeficiency virusherpes varicella zoster virusevelyn arthur saint john waughandrei dimitrievich sakharovrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitation
...View all with 26 letters...
Phrases (27)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkintaras grigoryevich shevchenkothrough empirical observationrodion romanovich raskolnikovaleksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinatrioventricular nodal rhythmsystema nervosum periphericum
...View all with 27 letters...
Phrases (20)
aleksandr feodorovich kerenskyfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyraphanus sativus longipinnatusfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyvladimir vladimirovich nabokovsergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakunin
...View all with 28 letters...
Phrases (16)
aleksandr nikolayevich scriabindmitri dmitrievich shostakovichsouth-central dravidian languagetheodore roosevelt national parkautoclaved lightweight concretesir paul gavrilovich vinogradofffyodor mikhailovich dostoyevskygrigori aleksandrovich potemkinbreach of the covenant of warrantyfeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (14)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovaalexander isayevich solzhenitsyndouble standard of sexual behaviorrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovmotion with variable accelerationrevelation of saint john the divineprovisional irish republican army
...View all with 30 letters...
Phrases (11)
united states public health servicemarie louise elisabeth vigee-lebrunanicius manlius severinus boethiusprimary subtractive color for lightislamic jihad movement in palestinewernher magnus maximilian von braunovulation method of family planningiosif vissarionovich dzhugashvilievangelical united brethren churchvladimir vladimirovich mayakovski
...View all with 31 letters...
Phrases (9)
nikolai andreyevich rimski-korsakovafrican american vernacular englishdepartment of the federal governmentsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovprimary subtractive colour for lightyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisbosnian-herzegovinian monetary unitPhrases (9)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefriedrich august kekule von stradonitzhermann ludwig ferdinand von helmholtzdepartment of health and human serviceseinstein's general theory of relativityeinstein's special theory of relativityunited states fish and wildlife serviceunited states house of representatives
