Words Containing: A,H,R,S,Y
(In Any Order)
There are 1,815 words,
1,724 phrases and
0 abbr's with
A,H,R,S,Y in.
Best Scoring Words With: A,H,R,S,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hyraxes | 7 | 20 | nounn | |||||
noun • any of several small ungulate mammals of Africa and Asia with rodent-like incisors and feet with hooflike toes | ||||||||
| harshly | 7 | 16 | adverbadv | |||||
adverb • in a harsh or unkind manner • in a harsh and grating manner | ||||||||
| swarthy | 7 | 16 | adjectiveadj | |||||
adjective satellite • naturally having skin of a dark color | ||||||||
| hryvnas | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sharply | 7 | 15 | adverbadv | |||||
adverb • in an aggressive manner • in a well delineated manner • changing suddenly in direction and degree • very suddenly and to a great degree | ||||||||
| starchy | 7 | 15 | adjectiveadj | |||||
adjective • consisting of or containing starch adjective satellite • rigidly formal | ||||||||
| brashly | 7 | 15 | adverb, adjectiveadv, adj | |||||
adverb • in a brash cheeky manner | ||||||||
| hyraces | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| marshy | 6 | 14 | adjectiveadj | |||||
adjective satellite • (of soil) soft and watery | ||||||||
| grayish | 7 | 14 | adjectiveadj | |||||
adjective satellite • of an achromatic color of any lightness intermediate between the extremes of white and black | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
syrahWords (53)
thursdayhysteriashipyardstracheyscratchycrayfishrhapsodyhoarselygarishlyrakishlyarchwaysvarnishyyachterseuphrasythruwayshalyardshydrantshayforkshydrateshayrickscharleysashtrayshryvniascharpoysabhenryssyrphianhearsayshydrasestrashilyhayrackshayrideshaywardshaywireswhipraysgrayfish
...View all with 8 letters...
Phrases (1)
rush awayWords (99)
hairstylescholarlyhairsprayhorseplaychrysalischarybdisseaworthyhusbandryanywheresforsythiahamadryasanhydrousdysphoriachrysalidhydrastisraffishlyoverhastyhygrostathydrolasefairishlyhaulyardshyracoidssyrphianshysteriaserythemasarythmiasmyographsphysiatrybirthdayspyorrheasstarchilyhymnariesshipyardsphrasallyyahrzeits
...View all with 9 letters...
Phrases (9)
ready cashheavy sparhair stylestay freshhair spraydray horsehenry's laweasy chairrat typhusWords (185)
hystericalhyperspacepsychiatryhydraulicsschoolyardpythagoraslachrymosesoothsayerfreakishlystraightlydisharmonyharmlesslydysarthriacrashinglysatyagrahasynchronalsaprophyteholidayersprankishlydehydratesgynarchiesthrowawayshydropathscoryphaeusdysphoriasrehydrateshairstylesshrievaltyaerophyteshydrangeashamadryadsmythmakershorseplayspolygraphsparaphyses
...View all with 10 letters...
Phrases (30)
henry jameshouse partythomas graylawyer bushschool yearrush familycrazy horsecrazy housemother's daysally forth
...View all with 10 letters...
Words (240)
psychiatrichorseplayerbaryshnikovbathyspheresympathizerhairstylistsphericallyphraseologyrhinoplastyhilariouslyhypogastricnasopharynxsympathiserphysiatristpsychodramamccarthyismheartlesslymisanthropyravishinglybreathalysescenographyprophylaxisdysrhythmiahyperplasiastenographysymposiarchhazardouslyplaywrightshoneyeatersthysanuransdehydratorshydroplanespsychographsaprophytessearchingly
...View all with 11 letters...
Phrases (33)
mary shelleysensory hairshy away fromchess playerthomas hardyrhus typhinathorny skateurban typhusprayer shawlpastry dough
...View all with 11 letters...
Words (277)
psychiatristchristianitystraightawayhistoricallyhystericallyastrophysicsharmoniouslybreathlesslypraiseworthythoracostomychrestomathyerythematoushaberdasherysuperhighwaydishonorablybreathalyserasynchronousstylographicdysmenorrheapolygraphisttracheostomysuperhumanlystonyheartedchivalrouslylachrymosityfarsightedlyoropharyngeshyperkinesiaunhystericalphysiocratichemihydratesparathyroidsstratigraphyseraphicallysympathizers
...View all with 12 letters...
Phrases (51)
barbary sheepchristmas daywatch crystalarthur symonsmass hysteriabirthday suitgenus sphyrnaharry s. trumanhylobates largenus corypha
...View all with 12 letters...
Words (249)
chrysanthemumpsychotherapyphysiotherapydehydrogenasehydrocephalustreacherouslypyrophosphatehydrodynamicsrhapsodicallysoutheasterlynightmarishlynortheasterlylymphosarcomaastrophysicaldishonourablysaccharomycesoystercatcherbrachypterousperishabilityhyaluronidasespermatophyteholidaymakerssoftheartedlyphosphorylatehypothecatorsprophylacticsphysiographerhymenopteranspharisaicallyhyperacuitiesyellowthroatsnonhystericalthrasonicallypyrocatecholssuperphysical
...View all with 13 letters...
Phrases (76)
harvey cushingel iskandriyahshammy leathersphyrna tiburothree kings' daygenus pyrrhulamusical rhythmhorse-and-buggyhouse of prayerdubose heyward
...View all with 13 letters...
Words (222)
astrophysicistthermodynamicsparapsychologynarcosynthesisphosphorylatedasynchronouslyplethysmographhydrotherapisthistoriographypraiseworthilypachydermatousstretchabilityphosphorylateshypermasculinedehydrogenaseshypermetropiasoystercatcherspyrimethamineshyperrealisticphytoplanktershistrionicallyhyperawarenesscryptographersparenchymatousunchivalrouslypseudepigraphyspermatophytesspermatophyticplethysmogramshyperesthesiasinharmoniouslyaphoristicallystoutheartedlylachrymositiesphosphorylases
...View all with 14 letters...
Phrases (85)
anthony burgessmyrrhis odoratablackberry bushchinese parsleyjapanese cherrygenus chrysaorahenry cavendisherythema solareartillery shellgenus sphyraena
...View all with 14 letters...
Words (184)
psychotherapistsynchronizationphysiotherapistheterosexualitysynchronisationcrystallographyneuropsychiatrypsychiatricallyultrasonographyimperishabilityphysiographicalpolysaccharidesastrophysicistspsychohistoriandishearteninglyhyperaggressivehypersalivationpsychometriciancyproheptadineshyperstimulatedhyperstimulatessaccharomyceteshypervigilanceshyperfastidiousionosphericallyphosphorylatingphosphorylationphosphorylativehyperinflationshypnotherapistshyperlipidemiashypermetabolismmethoxyfluranesatmosphericallylymphangiograms
...View all with 15 letters...
Phrases (115)
mrs. humphrey wardhyoscyamus nigerspiny-headed wormscholarly personarachis hypogaeashorthand typistmythical monsterchicory escaroledehydrated foodsthree-day measles
...View all with 15 letters...
Words (95)
catastrophicallysphygmomanometererythroblastosisthermostaticallyrhabdomyosarcomaparapsychologistneuropsychiatrichypersalivationsantistrophicallyspondylarthritishypersexualitiesthermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologiesparasympatheticsapocryphalnesseshypervitaminosessphygmomanometryhypocoristicallyglossopharyngealnonpsychiatristsarchaeoastronomythyrocalcitoninshypopituitarismsarchiepiscopallystenographicallycrystallographicstereophonicallyastrophotographyperiphrasticallylymphogranulomascaryophyllaceouspharmacodynamics
...View all with 16 letters...
Phrases (130)
christian huygensgenus crotaphytusacross the countrynevil shute norwayschool dictionarypharyngeal tonsilrheims-douay biblereligious holidayhenry schoolcraftthysanuran insect
...View all with 16 letters...
Words (49)
straightforwardlypsychotherapeutichyperreactivitiesphysiotherapeuticparaformaldehydeshyperstimulationsparapsychologistshyperventilationssphygmomanometersthrombocytopeniascrystallographerscrystallographiesbathythermographsstereophotographypheochromocytomastransthoracicallydehydrochlorinaseglossopharyngealsorthopsychiatriesorthopsychiatristtriphenylmethanesphosphoglyceratesgynandromorphismsneuropsychiatriesneuropsychiatristmesembryanthemumssuperheavyweightsdesynchronisationdesynchronizationanachronisticallydephosphorylatingdephosphorylationrhabdomyosarcomasrhynchocephaliansparapsychological
...View all with 17 letters...
Phrases (154)
division bryophytainterstate highwayclass rhodophyceaesubphylum craniataantipsychotic drugprimary censorshippetasites hybridusanas platyrhynchospython reticulatusst john's wort family
...View all with 17 letters...
Words (47)
characteristicallypsychopharmacologyhyperaldosteronismneuropsychologicalhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismlaryngopharyngitislipopolysaccharidelymphangiographiesstoichiometricallypteridospermaphytamucopolysaccharidehypercholesteremiasaccharomycetaceaedehydrochlorinasesdehydrochlorinatesorthopsychiatristsoscillographicallyspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesheavyheartednessespachycephalosaurusdephosphorylationsrhabdomyosarcomatarhinolaryngologistpseudoparenchymatachlortetracyclinespsychobiographicalhydrometallurgists
...View all with 18 letters...
Phrases (171)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyshort-term liabilityhypostasis of christarchitectural stylecrataegus oxycanthaarthur garfield haysgossypium herbaceum
...View all with 18 letters...
Words (26)
hyperparathyroidismhypersensitizationsparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidesphosphoenolpyruvatechromoblastomycosisthird-dimensionalityhysterosalpingogramthree-dimensionalitymethylcholanthreneshistoriographicallyparasympathomimeticpsychopharmacologicdiethylcarbamazineshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiesschizosaccharomycespolychromatophiliasPhrases (148)
hydrastis canadensisclass polyplacophoragiles lytton stracheygenus cryptobranchusgenus symphoricarposavogadro's hypothesiscalycanthus floriduschinese monetary unitbritish capacity unithydrobates pelagicus
...View all with 19 letters...
Words (30)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallycrystallographicallyhyperadrenocorticismlymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicselectrophysiologicalencephalomyocarditisphotophosphorylationpseudoparenchymatoushydrochlorothiazidespsychopharmacologiespsychopharmacologisthypercoagulabilitiespalatopharyngoplastydimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (130)
yellow-shafted flickerbalaenoptera physalusdivision tracheophytadianthus caryophyllusmilton snavely hersheyfriendly relationshipsouth american countryluscinia megarhynchosa-scan ultrasonographyhyperoodon ampullatus
...View all with 20 letters...
Words (11)
psychopharmacologicalotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologiesphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (120)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaarctostaphylos uva-ursihenry hobson richardsonagricultural chemistryhans holbein the youngersyngnathus hildebrandi
...View all with 21 letters...
Words (6)
spectrophotometricallyphosphoglyceraldehydesotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (94)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberhenry engelhard steinway
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (81)
family threskiornithidaekazakhstani monetary unitthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (2)
laryngotracheobronchitisschizosaccharomycetaceaePhrases (59)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprimary sex characteristictechnology administrationhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanumoxidative phosphorylation
...View all with 24 letters...
Words (1)
uvulopalatopharyngoplastyPhrases (50)
embryonal rhabdomyosarcomaigor fyodorovich stravinskymary wollstonecraft shelleysymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (38)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (32)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulussystema nervosum periphericum
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (23)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl celluloseaspidophoroides monopterygius
...View all with 28 letters...
Phrases (13)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (13)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (1)
respiratory distress syndrome of the newborn
