Words Containing: A,H,I,T
(In Any Order)
There are 11,212 words,
7,174 phrases and
1 abbr with
A,H,I,T in.
Best Scoring Words With: A,H,I,T
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| mitzvah | 7 | 24 | nounn | |||||
noun • (Judaism) a precept or commandment of the Jewish law • (Judaism) a good deed performed out of religious duty | ||||||||
| azimuth | 7 | 21 | nounn | |||||
noun • the azimuth of a celestial body is the angle between the vertical plane containing it and the plane of the meridian | ||||||||
| zaptiah | 7 | 21 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| zaptieh | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| thiazol | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| thiazin | 7 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
| xanthic | 7 | 19 | adjectiveadj | |||||
adjective • Of a yellowish colour. | ||||||||
| shiatzu | 7 | 19 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| jacinth | 7 | 19 | nounn | |||||
noun • a red transparent variety of zircon used as a gemstone | ||||||||
| haziest | 7 | 19 | adjectiveadj | |||||
adjective satellite • filled or abounding with fog or mist • indistinct or hazy in outline | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Abbreviations (1)
thaiWords (72)
hatingwraithshantihitmantaichitahitialightithacahiatusshaktiarightishtarwithalmithrapythiahestiatahinithaliahadithhatpinpathicfatihahalitehapticfaithsphaticbhaktilithiatahsilhiatalthoriasaithecanthihaintsairths
...View all with 6 letters...
Phrases (7)
tin hattai chit'ai chichip atin thathit manhot airWords (246)
alrightcharityhaircutbathingheatingcynthiamitzvahatheistchaoticethicalhabitatmathiascatfishwichitagoliathchariotwhitmaninhabitthwaitehalibuthastilyepitaphtarnishatheismshiatsuhalfwithaitianchiantianthillthawingantiochhairnetshaitanhaltingmarathi
...View all with 7 letters...
Phrases (15)
in hastebase hittax hikeshine athip bathhigh teathin airon faithbath oilham it up
...View all with 7 letters...
Words (589)
anythinghospitalstraightbirthdaywatchingpatheticteachingcheatinghumanitycatholiccatchingfaithfulalmightythailanddaylightchantingchattingwithdrawhesitatehappiestdispatchhamiltonmatchingheritageathletichauntingethiopiahastingshysteriachastitymythicalloathingchitchatairtighthalftime
...View all with 8 letters...
Phrases (56)
white antair shaftwhite mansmash hitwax lightin the rawin the waylight airhit squadtisha b'ab
...View all with 8 letters...
Words (1050)
christmasbreathingchristiannightmareelizabethauthoritycatherinetechnicalgatheringarchitecttherapistestablishspaghettiauthentichumiliatewithdrawnauschwitzwithstandhairstylenightfallanarchisthistorianauthorizebirthmarkthrashinghealthieraphroditearthritisaesthetichesitatedstarlighthelveticahepatitislabyrinthinhabited
...View all with 9 letters...
Phrases (116)
adam smiththink backwhite flagright awayedith piafwhite heatdirt cheaphair stylereal thingwhite meat
...View all with 9 letters...
Words (1403)
washingtonchatteringhistoricalstraightenhumiliatedhystericalauthorizedenthusiasmflashlightscratchingunfaithfulexhaustingtechnicianwithdrawalblacksmithhesitationwitchcraftshatteringcharitablepharmacisttheatricalhorizontalenchantingastonishedexhaustionanesthesiahereditaryanestheticantichristfahrenheitsympathizedistraughttriumphantbirthplacepsychiatry
...View all with 10 letters...
Phrases (215)
high statuselisha otiswhite camasstrike hardsun bathingelizabeth iflight pathright brainminute handchoir stall
...View all with 10 letters...
Words (1639)
threateningauthoritiestechnicallyestablishedafghanistanhumiliatinghandwritingpsychiatricinheritanceachievementpartnershipmathematicshumiliationhospitalityastonishingsympatheticheavyweighttheoreticalnightingaleunthinkableatmospherictherapeuticcandlelightcharismaticpathologistannihilatedwithdrawinghypothermiahibernationswitchboarddehydrationtchaikovskycatholicismanaestheticmatchmaking
...View all with 11 letters...
Phrases (293)
beam of lightcatha edulistribal chiefriding habithigh qualitytribal sheikboxing matchbreathing ingreat schismwalt whitman
...View all with 11 letters...
Words (1691)
relationshippsychiatristthanksgivingarchitecturechristianitydictatorshipcatastrophicenthusiastichospitalizedhumanitarianmathematicalhypocriticalphotographicbreathtakingstraightawaypathologicalheadmistressunauthorizedhypotheticalhistoricallyannihilationexhilaratingauthenticitymetaphysicalmythologicalalphabeticalpsychopathicarcheologisthystericallyhorizontallyasphyxiationastonishmenttechnicalitychiropractorrehabilitate
...View all with 12 letters...
Phrases (415)
tribal sheikhotolith organczech capitalcaptain blighcaptain hicksstar sapphireachille rattiathletic gameathletic typekitchen range
...View all with 12 letters...
Words (1429)
sophisticatedestablishmentauthorizationtheoreticallyhomosexualityhallucinatingtechnologicalhallucinationarchaeologistmathematicianarchitecturalautobiographyheartbreakingmetamorphosischaracterizedcraftsmanshiprehabilitatedpsychosomaticauthorisationlaughingstockauthenticatedsportsmanshipauthoritarianchristmastimephysiotherapyhermaphroditeuninhabitableauthenticatorinexhaustibleastonishinglypetrochemicalphilanthropicchateaubriandantihistamineauthoritative
...View all with 13 letters...
Phrases (475)
partial breachpaul hindemithwhite asbestosmight-have-beenwhite backlashgrain merchantbreathing timelouis the greatfrances wrighthydrated oxide
...View all with 13 letters...
Words (1220)
pharmaceuticalrehabilitationcharacteristichypotheticallyaccomplishmentclaustrophobiccinematographyanthropologistsophisticationmetaphoricallyapprenticeshipclaustrophobiaphilanthropistmathematicallyalphabeticallycardiomyopathyastrophysicistpathologicallythermodynamicscholinesterasehyperventilatepsychoanalyticunfaithfulnessornithologicalauthenticationstraightjacketrehabilitatingmetaphysicallytelepathicallyschoolteachingscholasticallynarcosynthesisnonthreateningosteoarthritisunenthusiastic
...View all with 14 letters...
Phrases (480)
thoracic cavitycapital of ghanapaleolithic agebreathing placebreathing spacebreathing spellcastle in the airto a higher placecapital of idahomyrrhis odorata
...View all with 14 letters...
Words (913)
straightforwardcinematographerpsychotherapistmethamphetaminetechnologicallynotwithstandingsynchronizationpithecanthropusophthalmologistunsophisticatedhospitalizationphotojournalistanaesthesiologyinterchangeablephysiotherapistanthropologicalheterosexualitywhatchamacallitparthenogenesissympathomimeticschistosomiasissadomasochisticcinematographicphotojournalismanthropomorphicinterscholasticparentheticallydistinguishabletherapeuticallysynchronisationhospitalisationenfranchisementmethylphenidatemicrophotographanticholinergic
...View all with 15 letters...
Phrases (604)
bitter chocolatehonduran capitalcaltha palustriscapital of hawaiinewton's third lawjacques lipchitzacheta assimilisacheta domesticaitalian sandwichhigh temperature
...View all with 15 letters...
Words (356)
enthusiasticallyautobiographicalanesthesiologistcharacterizationaustralopithecuscatastrophicallytriphenylmethanehyperventilationpsychoanalyticalchemotherapeuticphylogeneticallyuncharacteristicpharmaceuticallytrichotillomaniaerythroblastosisthermostaticallythrombocytopeniadiphthongizationanthropomorphismcharacterisationoverenthusiasticlightheartednessphotographicallyanthropomorphiseanthropomorphizeophthalmologicalbiotechnologicalunderachievementparapsychologistacquaintanceshipauthoritarianismneuropsychiatricnorthamptonshireradioautographicthermolabilities
...View all with 16 letters...
Phrases (574)
manihot esculentaitalian greyhoundchelonian reptilechristian huygensphotographic filmcapital of hungarybattle of philippicaptain john smithnathaniel currierochotona princeps
...View all with 16 letters...
Words (228)
indistinguishablestraightforwardlyanthropologicallyparathyroidectomytriskaidekaphobiathermodynamicallyphilanthropicallypsychotherapeuticelectromechanicaldextroamphetamineinterrelationshiphyperreactivitiesnonmathematiciansradioautographiesantischizophreniaantischizophrenicphysiotherapeuticradiochromatogramspectroheliogramsunexchangeabilityspectroheliographleukoencephalitisantitechnologicalkindheartednessesdisestablishmentshyperstimulationsthermoregulationsdisfranchisementsparapsychologistsradiotelegraphiesinheritablenessesthermostabilitieshyperventilationsmonochromaticallyhypnotizabilities
...View all with 17 letters...
Phrases (653)
horizontal sectioncapital of ethiopiaheat of sublimationmanihot utilissimacompetence hearingkatsushika hokusaidivision bryophytacivil rights leaderclomiphene citrateczech monetary unit
...View all with 17 letters...
Words (132)
characteristicallyanthropomorphizinghypercoagulabilitypsychopathologicalhyperaldosteronismdisenfranchisementinterchangeabilityhypersensitizationradiochromatogramsspectroheliographsspectroheliographythermoplasticitiesinhospitablenessesfaintheartednessesmonochromaticitiespsychotherapeuticssphygmomanometriesarchaeoastronomieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricityrechromatographiesrechromatographinglaryngopharyngitislightheartednessespostpsychoanalyticastrophotographiesstereophotographicpraiseworthinessesaustralopithecinesimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphyta
...View all with 18 letters...
Phrases (556)
hindu calendar monthwashington monumentheat of vaporisationtuamotu archipelagodivision anthophytaheat of vaporizationfamily physeteridaedame sybil thorndikehindustani languagelachrymal secretion
...View all with 18 letters...
Words (99)
hyperparathyroidismhydrochlorothiazidepseudohermaphroditecinematographicallystraightforwardnessdisenfranchisementshypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsencephalomeningitisglottochronologicalstereophotographiesresorcinolphthaleinanarcho-collectivismauthoritativenessescytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicimmunohematologicalimmunohematologistsimmunohistochemicalphenomenalisticallyphenylthiocarbamidepseudohallucinationelectrocardiographschromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosisphosphofructokinaseneuropharmacologist
...View all with 19 letters...
Phrases (541)
rejoicing over the lawcivil rights activisthydrastis canadensistheodore harold whiteread between the linesgiles lytton stracheyphytolacca americanahandle with kid glovesdivision schizophytabattle of saint-mihiel
...View all with 19 letters...
Words (65)
uncharacteristicallyhypercholesterolemiaanthropomorphizationoverenthusiasticallytetrahydrocannabinolsemiautobiographicalspectroheliographiesradiopharmaceuticalsspectrophotometricalparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilityimmunocytochemicallylymphogranulomatosisdistinguishabilitiesbacteriochlorophyllsphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneuropsychiatricallycontradistinguishinghyperlipoproteinemiaadrenocorticotrophicphotoautotrophicallyadrenocorticotrophinmagnetohydrodynamicselectrooculographieshistoincompatibility
...View all with 20 letters...
Phrases (453)
gilbert charles stuarthonduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaephotographic emulsionfamily trachipteridaebusiness relationshipmarchantia polymorphadivision tracheophyta
...View all with 20 letters...
Words (25)
disestablishmentarianotorhinolaryngologiststraightforwardnessesestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismadrenocorticotrophinsotorhinolaryngologiesmeningoencephalitideselectromyographicallyelectroretinographiesanthropomorphizationsphotolithographicallyantiauthoritarianismspseudocholinesterasesphotophosphorylationspseudosophisticationshypercholesterolemiaspsychopharmacologistsindistinguishablenesspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (389)
acrocentric chromosomesir john everett millaisadministrative hearingcercopithecus aethiopshelianthemum scopariumanaphalis margaritaceaaleksandr solzhenitsynanthriscus cereifoliumhelichrysum bracteatumphilosophical doctrine
...View all with 21 letters...
Words (9)
disestablishmentariansspectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesestablishmentarianismsindistinguishabilitiesPhrases (314)
gregorian calendar monthhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridebarbara wertheim tuchmanaleksandr i. solzhenitsynviola tricolor hortensisjohn ronald reuel tolkienmultiple mononeuropathy
...View all with 22 letters...
Words (5)
electroencephalographichexamethylenetetraminesdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiaPhrases (209)
family threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatechlorpheniramine maleateelectromechanical devicesir richard francis burtonaugust wilhelm von hofmannkazakhstani monetary unitcalycanthus occidentalis
...View all with 23 letters...
Words (8)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographiesmicroelectrophoreticallydichlorodifluoromethanesschizosaccharomycetaceaePhrases (176)
division heterokontophytaprivately held corporationtrip the light fantastic toeprimary sex characteristicbattle of the little bighornbattle of the philippine seabattle of the spanish armadaadolf otto reinhold windauscapital of northern irelanddmitri ivanovich mendeleev
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (134)
igor fyodorovich stravinskybattle of the chemin-des-damessymphoricarpos orbiculatuschemical weapons conventioncruel and unusual punishmentdistinguished service medaltherapeutic rehabilitationboris leonidovich pasternakrudolf christian karl dieselwar of the spanish succession
...View all with 25 letters...
Phrases (108)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritancebacon-lettuce-tomato sandwichnational institutes of healthright atrioventricular valvealternanthera philoxeroides
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (65)
nikita sergeyevich khrushchevelectromechanical transduceraugustus welby northmore pugindirector-stockholder relationjerusalem artichoke sunfloweradrenocorticotrophic hormonedeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (70)
oxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdemocratic republic of the congoraphanus sativus longipinnatus
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (40)
chemical decomposition reactionfriedrich wilhelm august froebeldisorganized type schizophreniadmitri dmitrievich shostakovichcapital of the dominican republicsouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitferdinand joseph la menthe mortoncongregational christian church
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (33)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovaalexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultethylenediaminetetraacetic acidaugust friedrich leopold weismannwaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (30)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrundigital communications technologyfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusprimary subtractive color for lightislamic jihad movement in palestine
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (16)
hierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationedmond louis antoine huot de goncourtyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzki
...View all with 32 letters...
Phrases (23)
characteristic root of a square matrixbreach of trust with fraudulent intentepistle of paul the apostle to philemonbureau of alcohol tobacco and firearmsorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junction
...View all with 33 letters...
Phrases (19)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzhermann ludwig ferdinand von helmholtzdryopithecus rudapithecus hungaricusmassachusetts institute of technology
...View all with 34 letters...
Phrases (13)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadeimmaculate conception of the virgin maryhereditary motor and sensory neuropathychristopher william bradshaw isherwoodfederal democratic republic of ethiopiatransurethral resection of the prostate
...View all with 35 letters...
Phrases (11)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weber
...View all with 36 letters...
Phrases (12)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyatheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentdepartment of health education and welfareepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatians
...View all with 37 letters...
Phrases (7)
second epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilleeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityepistle of paul the apostle to the colossiansPhrases (7)
islamic jihad for the liberation of palestinerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtzepistle of paul the apostle to the philippiansPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing
