Words Containing: A,G,S,H,I,P
(In Any Order)
There are 1,289 words,
813 phrases and
0 abbr's with
A,G,S,H,I,P in.
Best Scoring Words With: A,G,S,H,I,P
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| shaping | 7 | 13 | verb, nounv, n | |||||
noun • any process serving to define the shape of something • the act of fabricating something in a particular shape adjective satellite • forming or capable of forming or molding or fashioning | ||||||||
| phasing | 7 | 13 | verbv | |||||
noun • any distinct time period in a sequence of events • (physical chemistry) a distinct state of matter in a system; matter that is identical in chemical composition and physical state and separated from other material by the phase boundary • a particular point in the time of a cycle; measured from some arbitrary zero and expressed as an angle • (astronomy) the particular appearance of a body's state of illumination (especially one of the recurring shapes of the part of Earth's moon that is illuminated by the sun) verb • arrange in phases or stages • adjust so as to be in a synchronized condition | ||||||||
| pashing | 7 | 13 | verb, nounv, n | |||||
verb • To snog, to make out, to kiss. • To throw (or be thrown) and break. • To strike; to crush; to smash; to dash into pieces. | ||||||||
| hasping | 7 | 13 | ||||||
verb • To shut or fasten with a hasp. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (45)
spaghettisplashingserigraphreshapingsiphonagehandgripsflagshipsoesophagiagraphiasisographsgraphitesscarphingepigraphsdysphagicphilabegsskiagraphphrasingspharmingsdysphagianightcapstrigraphsdiagraphspotashingairgraphsphansigargraphiumshairgripsmageshipshypalgiaspatchingsfig-shapedpigwashesunhaspingguardshippoachings
...View all with 9 letters...
Phrases (2)
cargo shipguard shipWords (97)
purchasinghandspringshampooingspirographrephrasingheadspringlegateshipmisshapinghappeningsgraphemicsspaghettisideographsasphaltingdiaphragmsplanishingserigraphssarcophagiskiagraphssharpeningserigraphyplaythingsgypsophilasiphonageshagioscopecoliphagesprewashingdysphagiasspringheadgeophagiasgeophagiesomophagiashairspringsulphatingomophagiesphreakings
...View all with 10 letters...
Phrases (7)
genus aphisbirth pangscargo shipsstrap hingewhite pageswishing capstraight upWords (146)
pathologistspaghettiniblasphemingseismographgeophysicalhypogastricemphasizingesophagitissemaphoringemphasisinggraphicnessgeneralshipgeographicschampignonsmycophagistlegateshipsplaywrightsorographiesdispatchinglightplanesepigraphiesmanagershipspringheadsphantasyinghandspringspictographsmycophagiesdespatchingserigrapherradiographsempathisingpathologiesmicrographsbiographersbiographies
...View all with 11 letters...
Phrases (19)
genus phaiussailing shipship's galleyspring heathhagia sophiawhaling shipgenus harpiashaping toolgenus raphialamp housing
...View all with 11 letters...
Words (199)
guardianshipspeechmakinggamesmanshipstenographicpackinghousesuperhighwayhypogonadismstylographicoscillographpolygraphistgraphologistasphyxiatingsympathisingtrapshootingtelegraphistrhapsodizingresharpeningphotostatingspaghettinisstratigraphyvenographiesgraphologiessympathizingsonographiesphrasemakingtranshippingspearheadingseismographyrepurchasingtelegraphiesdemographicsmycophagistsxerographiestomographiesserigraphers
...View all with 12 letters...
Phrases (22)
shaking palsyshell platinggenus xiphiasshopping cartshopping mallstraighten upstage whisperphallic stagedashing hopeshasty pudding
...View all with 12 letters...
Words (243)
psychologicalphysiologicalhairsplittingsharecroppingalphabetisingseismographicsharpshootingpigheadednesshospitalizingcalligraphistapotheosizingphagocytosingaccomplishinghagiographiesphotoscanningiconographersiconographiesphotostattingspaghettilikereprographicsreprographiesphysiographergraphologistsvideographersgeophysicallycolleagueshipaortographiesphotographiestelegraphistsstenographiesangiographiesreemphasizingradiographiescheeseparingspolygraphists
...View all with 13 letters...
Phrases (48)
stephen girardgenus haemopisblighia sapidaspanish guineashoe repairingthermal springgenus hepaticagaussian shapesparring matchcatch a glimpse
...View all with 13 letters...
Words (196)
anthropologistpharmacologistspectrographicphantasmagoriahistoriographyoceanographiesantiphlogisticstereographingmetamorphosingpseudepigraphacalligraphistscinematographsmisemphasizingcolleagueshipshairsplittingschronographiesbacteriophagesfluorographieslexicographersparenthesizingpseudepigraphysophisticatingsuperhardeningphlebographiesichthyophagousstratigraphiesseismographersseismographiescardiographiesmastigophoranssharpshootingsplaywrightingsstereographiesphantasmagoricpolarographies
...View all with 14 letters...
Phrases (53)
breathing spacebreathing spellstephen hawkinggenus phasianuspanthera tigrissporting chancexiphias gladiuschampignon soupphysical changegenus amphioxus
...View all with 14 letters...
Words (157)
psychologicallyophthalmologistphysiologicallyparthenogenesismetallographiesposthemorrhagicarteriographiesphysiographicalpigheadednessespsychoanalyzingphotoengravingsautoradiographsautobiographershistoriographichyperaggressivemisapprehendinghypervigilancesoveremphasizingphosphorylatingpreestablishinganthropologistsprosopographiesanthropophagiesmicrobarographsgraphitizationslymphangiogramsphantasmagoriasencephalitogenslegislatorshipssporangiophoresophthalmologieswappenschawingsphysiopathologypsychobiographyrehospitalizing
...View all with 15 letters...
Phrases (73)
belgian shepherdgenus gnaphaliumarachis hypogaeagenus phalangiumspaghetti squashgenus phragmitesspanish languagedispersing phasegenus himantopusgenus rhinoptera
...View all with 15 letters...
Words (55)
psychobiologicalparapsychologistspectroheliogramhyperstimulatingparapsychologiesnonpsychologicalpathophysiologicweatherstrippingphantasmagoricalstenographicallycrystallographicopisthognathidaepharmacogeneticslymphangiectasialymphangiectasisecophysiologicalophthalmologistsphonocardiogramsbiostratigraphicneuropathologiesneuropathologistgynandromorphiesgynandromorphismmetapsychologiessuperheavyweightphotogrammetriesphotogrammetristsharp-sightednessultrasonographicprosopographicalphotolithographsphotomicrographshistopathologieshistopathologistpseudepigraphies
...View all with 16 letters...
Phrases (70)
pharyngeal tonsilpolishing machineplatanus wrightiisuper heavyweightpillar of strengthgenus trichophagagenus sphyrapicuspassenger vehiclesimplex algorithmgenista hispanica
...View all with 16 letters...
Words (45)
radioautographiesspectroheliogramsspectroheliographparapsychologistsradiotelegraphiespathophysiologiescrystallographiesautoradiographiespharmacognosticalimmunopathologiesimmunopathologistxeroradiographiesphonocardiographsbiostratigraphiesneuropathologistsgynandromorphismsphotocoagulationsmetapsychologicalphotodisintegratesuperheavyweightsnonanthropologistphotodissociatingphotogrammetristsdephosphorylatingultrasonographiesencephalographieshistopathologicalroentgenographieshistopathologistsparapsychologicalhistoriographicalcholangiographiespsychobiographerspsychobiographiesphototelegraphies
...View all with 17 letters...
Phrases (82)
gopherus agassiziigenus globicephalaophiophagus hannahantipsychotic drugtypha angustifoliaavoirdupois weightgenus phalaenopsisplastering machinehavasupai languagegenus callistephus
...View all with 17 letters...
Words (34)
psychopathologicalsociopsychologicalneuropsychologicalspectroheliographsspectroheliographysphygmomanometriespathophysiologicalrechromatographieslaryngopharyngitisastrophotographiesstereophotographiclymphangiographiesmacrophotographiesechocardiographersechocardiographiesimmunopathologistsoscillographicallyspectrographicallyelectromyographiesphotodisintegratedphotodisintegratesnonanthropologistshemoglobinopathiesphotolithographiesphotomicrographieshistophysiologicalpsychobiographicalmicrophotographersmicrophotographiesphysiopathologicalpsychopathologistsmicroradiographiesneurophysiologicalhyperpigmentationsPhrases (68)
freudian psychologyantipsychotic agentgallinula chloropusgossypium herbaceumsolidago spathulataacoustic gramophonegenus dimorphothecageophysical sciencesetophaga ruticillawhispering campaign
...View all with 18 letters...
Words (24)
psychophysiologicalencephalomeningitisstereophotographiescytopathogenicitieselectrocardiographsphonocardiographiesneuropharmacologiesneuropharmacologisthysterosalpingogrammeningoencephalitisphotodisintegratingphotodisintegrationangiocardiographiesphotofluorographieselectroretinographsballistocardiographhistopathologicallyhistoriographicallychromolithographerschromolithographiespsychopharmacologicphytohemagglutininspaleoanthropologiespaleoanthropologistPhrases (64)
genus symphoricarposavogadro's hypothesishydrobates pelagicustragelaphus imberbisdolichotis patagonumgerard manley hopkinsgenus delphinapterusharmonic progressionthe great compromisercapital of washington
...View all with 19 letters...
Words (18)
semiautobiographicalspectroheliographiescrystallographicallylymphogranulomatosisoophorosalpingectomyneuropharmacologistsneurophysiologicallyelectrooculographiesphotodisintegrationselectrophotographieselectrophysiologicalpsychopathologicallypsychopharmacologiespsychopharmacologisthypercoagulabilitiesnephroangiosclerosisplethysmographicallypaleoanthropologistsPhrases (61)
photographic emulsionhendrik petrus berlagemetallographic samplegaultheria procumbenspass with flying colorsralph vaughan williamsapostle of the gentilessaturday night specialrhizopogon idahoensiscapital of afghanistan
...View all with 20 letters...
Words (6)
psychopharmacologicalelectrocardiographiesmeningoencephalitideselectroretinographiespsychopharmacologistspsychophysiologicallyPhrases (49)
anaphalis margaritaceastephen william hawkingarithmetic progressionphysiological propertyphysostegia virginianathoracoepigastric veinstone splitting machinegentianopsis thermalisdivision magnoliophytagenus macrothelypteris
...View all with 21 letters...
Words (1)
electrophysiologicallyPhrases (43)
gotthold ephraim lessingmetallographic specimencharlotte perkins gilmanmalaxis ophioglossoideshot springs national parkgentianopsis holopetalasubdivision ginkgophytaexperimental psychologysagebrush mariposa tulipencephalitis lethargica
...View all with 22 letters...
Words (1)
electroencephalographiesPhrases (25)
pelham grenville wodehouseargyroxiphium sandwicensetrip the light fantastic toejean louis rodolphe agassizpaul johann ludwig von heysedivision gymnospermophytasubdivision ginkgophytinaconstitutional psychologypityrogramma chrysophyllagospel according to matthew
...View all with 24 letters...
Phrases (12)
command processing overheadgreat plains of north americaprairie white-fringed orchisgasterophilus intestinalisbattle of pittsburgh landingsuperorder acanthopterygiidisorganized schizophreniaplastic blow molding machinepotassium hydrogen tartrateaspalathus cedcarbergensis
...View all with 25 letters...
Phrases (19)
charlotte anna perkins gilmanshort-spurred fragrant orchidalpine enchanter's nightshadearab states of the persian gulfbenign prostatic hyperplasiachristoph willibald von gluckplastic blow moulding machinepotassium hydrogen carbonateneohygrophorus angelesianuscalamintha nepeta glantulosa
...View all with 26 letters...
Phrases (15)
aleksandr sergeyevich pushkinaugustus welby northmore puginthyrotropin-releasing hormonecryptobranchus alleganiensisthrough empirical observationhypothalamic releasing factorhippoglossoides platessoidespeople's republic of bangladeshadeline virginia stephen woolfjohannes evangelista purkinje
...View all with 27 letters...
Phrases (12)
ephippiorhynchus senegalensisgallinula chloropus cachinnansraphanus sativus longipinnatusaspidophoroides monopterygiushypothalamic releasing hormonegates of the arctic national parkright to the pursuit of happinessgiovanni virginio schiaparellibovine spongiform encephalitispan troglodytes schweinfurthii
...View all with 28 letters...
Phrases (1)
subacute sclerosing leukoencephalitis
