Words Containing: A,E,R,E
(In Any Order)
There are 24,465 words,
16,745 phrases and
0 abbr's with
A,E,R,E in.
Best Scoring Words With: A,E,R,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
cerveza | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
trapeze | 7 | 18 | nounn | |||||
noun • a swing used by circus acrobats | ||||||||
marquee | 7 | 18 | nounn | |||||
noun • large and often sumptuous tent • permanent canopy over an entrance of a hotel etc. | ||||||||
rewaxed | 7 | 18 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
exhedra | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
zareeba | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
reglaze | 7 | 17 | verbv | |||||
verb • To glaze again | ||||||||
rewaxes | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
realize | 7 | 16 | verbv | |||||
verb • be fully aware or cognizant of • perceive (an idea or situation) mentally • make real or concrete; give reality or substance to • earn on some commercial or business transaction; earn as salary or wages • convert into cash; of goods and property • expand or complete (a part in a piece of baroque music) by supplying the harmonies indicated in the figured bass | ||||||||
freeway | 7 | 16 | nounn | |||||
noun • a broad highway designed for high-speed traffic | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (813)
teachergeneralrealizeearlierlearnedbreatheseveralcreatedpreparereleaseweathertreatedtheaterrelatedfederalaveragegreaterreplacerealiseeternaltheatredreamedleadersmeasureclearedheatherleathereasternretreatoperateembracesweaterrelaxeddeclarecleaner
...View all with 7 letters...
Phrases (30)
le havrebeer canred meatherb teasea haretea rosele carrelead orered heatred lead
...View all with 7 letters...
Words (1862)
whateveranywherepleasuregreatestpreparedresearchsergeantrealizedeverydaytreasureseparatereleasedcreatureelevatorentrancefarewellincreasecreativeeuropeanrelativegatheredthreatenreplacedtoleraterealisedforeheaddeclaredlawrencetraveledbarbecuereliableteenagermeasuresdisagreepersuade
...View all with 8 letters...
Phrases (125)
free fallsea horsefire salezane greysewer gascar wheelreal lifebare bonered laverbeer hall
...View all with 8 letters...
Words (3084)
yesterdaynecessarycelebratecigarettetreatmentsecretaryagreementnewspaperdesperateguaranteemiserableunderwearadventureseparatedcatherinealexanderrehearsaljerusalempermanentcooperatewarehousegenerallypassengerbatteriesincreasedbriefcaseencourageentertaindeparturelegendarybartenderheartbeatshatteredscatteredgenerator
...View all with 9 letters...
Phrases (334)
small beergreat sealpipe dreamrelated tocereal boxseed pearlair letterrange polein earneston average
...View all with 9 letters...
Words (3709)
appreciatesweetheartdepartmentgenerationatmospherethreatenedunderneathreasonableappearanceresistanceaggressiveliteratureremarkableelectricalvulnerableearthquakewhatsoevervegetarianunderwaterguaranteedunbearablewheelchairaltogetherregardlessleadershipscreenplayelementarymanchesterexaggerateheadmastercelebratedirrelevantrehearsingrelativelyencouraged
...View all with 10 letters...
Phrases (592)
mary leakeycover platedwarf elderair cleanerline backeredgar degasspace probelake nasserbrya ebenusedgar guest
...View all with 10 letters...
Words (3844)
performanceconcentrateembarrassedtemperaturethreateningtransferrednecessarilycelebratingcertificatecelebrationalternativeshakespearesupermarketarrangementreservationreplacementwhereaboutsdemonstratedesperatelyunnecessaryrespectablemasterpieceappreciatedinheritancecheerleaderhairdressermerchandisepermanentlypredictableexaggerateddesperationeverlastinginterrogateconsiderateresemblance
...View all with 11 letters...
Phrases (897)
name dropperpole vaultergreat revoltbitter aloesgenus crambe's gravenhagebarrel makerweather sidegeorge lucasmeat grinder
...View all with 11 letters...
Words (3395)
headquarterssurveillancepresentationrefrigeratorkindergartenpresidentialentertainingarchitecturedeliberatelyconservativehandkerchiefexaggeratingexperimentalconcentratedunreasonableconsiderablecheerleadingchemotherapydemonstratedinterrogatedheterosexualfrankensteinveterinarianpenitentiarytroublemakertransvestitepreservationperseverancedisagreementacceleratingheadmistressimpenetrableaggressivelyincarceratedexaggeration
...View all with 12 letters...
Phrases (1148)
graham greenehard-to-pleasetrouble makerel libertadorhelen traubelgrain cleanerarnold gesellcarniolan beemarcel breuerjan tinbergen
...View all with 12 letters...
Words (2566)
entertainmentunderestimateenvironmentaldisappearanceembarrassmentdeterminationunpredictablemediterraneanunnecessarilyunforgettabletheoreticallyencouragementadvertisementschoolteacherchoreographereavesdroppingexterminationinconsiderateirreplaceableheartbreakingdifferentiatedeterioratingquestionnaireindescribableschadenfreudedeteriorationinadvertentlycharacterizedrehabilitateddisintegratedtemperamentalmagnetospherepreliminariesassertivenessrefrigeration
...View all with 13 letters...
Phrases (1358)
telegraph postgenus blaberusremovable diskdelphic oracletrade stoppageauditory sensepar excellenceblood relativechelone glabragrass parakeet
...View all with 13 letters...
Words (1993)
representativerecommendationinterpretationunderstandablerepresentationreconnaissanceslaughterhouseunderstatementwholeheartedlyelectronicallyapprenticeshipimpressionableantidepressantunrecognizablecontemporariesnewspaperwomanaggressivenessrespectabilityextraordinaireunpremeditatedmeteorologicalinterplanetaryaforementionedundersecretarytranscendentalelectroplatingmountaineeringpancreatectomynebuchadnezzarcholinesteraseelectrotherapyattractivenessinternationalehyperventilateindecipherable
...View all with 14 letters...
Phrases (1464)
imperative formnegeri sembilanpassover supperimperative moodpearl mae baileyimperative verbweather outlookgarageman's liengelatin dessertcircuit breaker
...View all with 14 letters...
Words (1436)
electromagneticrevolutionariescinematographerexperimentationenvironmentallyentrepreneurialdisenfranchisedinterchangeableoverzealousnessunpronounceableintercollegiatespermatogenesisdifferentiationheterosexualitymisapprehensionparthenogenesisdifferentiatingparentheticallyplenipotentiaryappropriatenessgastroenteritisneoconservativemaneuverabilitytherapeuticallyenfranchisementnonexperimentalcounterargumentencephalographycerebrovascularpostoperativelyreapportionmentrecertificationundemonstrativereinvestigatingrematerializing
...View all with 15 letters...
Phrases (1576)
measuring deviceteutoburger waldcentaurea cyanuscharlotte brontedame muriel sparkfalco peregrinusbitter chocolateoutside marriagehigh renaissancealimentary paste
...View all with 15 letters...
Words (600)
extraterrestrialintercontinentalenvironmentalistelectromagnetismneurotransmitterundersecretariesenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationchemotherapeuticreinterpretationunreasonablenesselectromagneticselectromyographysphygmomanometerdemineralizationovercompensationinterpretationalextemporaneouslyinterventriculararteriosclerosisoverenthusiasticpredeterminationcompartmentalizelightheartednessunattractivenessgastroesophagealundifferentiateddecentralizationunderachievementexteriorizationsthermolabilities
...View all with 16 letters...
Phrases (1496)
tympanic membranecommedia dell'arteczar alexander iiidame kiri te kanawain a beastly mannercartridge ejectorprofessional lifegenus crassostreagenus elaeocarpusedgar albert guest
...View all with 16 letters...
Words (383)
depersonalizationmisinterpretationintergovernmentaltranscendentalismmisrepresentationelectrocardiogramcompartmentalizedelectrostaticallycontemporaneouslytranscendentalistcompartmentalisedinappropriatenesspsychotherapeuticelectromechanicaldextroamphetamineuncomfortablenessinterrelationshipdematerializationinterdepartmentalhyperreactivitiescountersignaturesinextricabilitiesirrevocablenessescounterstatementsisoelectronicallyparadoxicalnessesphysiotherapeuticcercidiphyllaceaespectroheliogramscomfortablenessesparaformaldehydesspectroheliographcounterstrategiescounterstrategistinformativenesses
...View all with 17 letters...
Phrases (1453)
jacqueline cochranweather forecasterdame margot fonteynmary leontyne pricecompetence hearingdirect correlationpontederia cordatalandscape gardenergenus ceratosauruscivil rights leader
...View all with 17 letters...
Words (217)
gastroenterologisthyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitypolyesterificationexterritorialitieshypersensitizationcommensurabilitiesspectroheliographselectrodynamometercounterstrategistsmisinterpretationsspectroheliographythermoplasticitiesinharmoniousnessesmisrepresentationsradiosensitivitiesunpredictabilitiesdishonorablenessesfaintheartednesseslandlubberlinessesrambunctiousnesseslargeheartednessesunprofitablenessesarteriolosclerosisappreciativenessesunreasonablenessespsychotherapeuticsapprehensivenessesdisintermediationssphygmomanometriesarchaeoastronomieslepidopterologicalunrestrainednesses
...View all with 18 letters...
Phrases (1270)
arteria vertebralisdouble-deck carriageprofessional golfererinaceus europaeusamerican revolutionphotographer's modelfamily physeteridaeanamnestic reactiondame sybil thorndikebackspace character
...View all with 18 letters...
Words (140)
countertransferencesternocleidomastoidpseudohermaphroditepneumoencephalogrampolyesterificationsdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesextraterritorialityparathyroidectomiessurface-assimilativehypolipoproteinemiaparthenogeneticallycomplementarinessesreconceptualizationdisrespectabilitiesstereophotographiesresorcinolphthaleincounterdemonstratorcytodifferentiationauthoritativenessesperspicaciousnessesgastroenterologicalgastroenterologistsgedankenexperimentsinteravailabilitiesphenylthiocarbamideprefigurativenessesreinstitutionalizedelectrocardiographsreinstitutionalizesechoencephalographyelectrocorticogramsmercury-contaminated
...View all with 19 letters...
Phrases (1036)
measuring instrumentfavourable receptionerinaceus europeaeusfamily cyclopteridaesierra madre orientalrejoicing over the lawseventeen-year locusttheodore harold whitecollective agreementturbo-propeller plane
...View all with 19 letters...
Words (67)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyelectroencephalogramparadichlorobenzenesspectroheliographieskeratoconjunctivitescountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenessunsatisfactorinessesreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicadrenocorticosteroidphosphoenolpyruvatesrepresentationalismsrepresentationalistsphosphomonoesteraseshyperlipoproteinemiarepresentativenesseselectrooculographiesdestructive-metabolicelectrophotographiesinappreciativenesseselectrophysiological
...View all with 20 letters...
Phrases (868)
sweet-scented geraniumarcheological remainsallium cepa aggregatumpelecanus onocrotalusgilbert charles stuartyellow-shafted flickerappendicular skeletonorder mycelia steriliaprofessional relationpast progressive tense
...View all with 20 letters...
Words (30)
electroencephalographdisestablishmentarianextraterritorialitiesstereomicroscopicallyconstructive-metabolicstraightforwardnessesestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalelectroencephalogramscontemporaneousnessesadrenocorticosteroidsphosphoglyceraldehydeelectromyographicallyovercommercializationelectroretinographiespolyvinyl-formaldehydepseudocholinesterasesarenaria-melanocephalacountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenesseshypercholesterolemiaspsychotherapeuticallycounterinterpretationPhrases (685)
use of goods and servicesacrocentric chromosomesir john everett millaissierra madre occidentaladministrative hearingelimination tournamenthead and shoulders abovesierra nevada mountainsfrances hodgson burnettexperimental condition
...View all with 21 letters...
Words (20)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismelectroencephalographselectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineencephalomyocarditisescountercountermeasuresdihydroxyphenylalanineestablishmentarianismscounterinterpretationsPhrases (556)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphustransient global amnesiaschlumbergera truncatuscoronavirus disease 2019posterior nasal apertureredevelopment authorityhydrated aluminium oxide
...View all with 22 letters...
Words (10)
electroencephalographicnonrepresentationalismselectroencephalographercarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethanehypobetalipoproteinemiaPhrases (353)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attackgeorge macaulay trevelyanchlorpheniramine maleateto all intents and purposesarchibald percival wavellboeing b-52 stratofortressyellowstone national park
...View all with 23 letters...
Words (9)
microgramma-piloselloideshyperbetalipoproteinemiaelectrocardiographicallyelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (328)
basque homeland and freedomcarnegie mellon universitylouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaprivately held corporationtrip the light fantastic toe
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyantiestablishmentarianismPhrases (261)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4myroxylon balsamum pereiraebalaenoptera acutorostratabureau of justice assistancebureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedradiamond wedding anniversary
...View all with 25 letters...
Phrases (178)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housefrances eliza hodgson burnettx-linked dominant inheritanceconfederate states of americaright atrioventricular valvebattle of the teutoburg forestbrassica oleracea gongylodespolicing and enforcement cost
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (124)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transducersolenostemon scutellarioides
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (115)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concord
...View all with 28 letters...
Phrases (93)
business environmental analysisbusiness interruption insurancealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophrenia
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (62)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligence
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (61)
united states public health servicebureau of intelligence and researchfreedom from involuntary servitudemarie louise elisabeth vigee-lebrun2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine colette
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (41)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciation
...View all with 32 letters...
Phrases (36)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagelycopersicon esculentum cerasiformeobject-oriented programming languagebureau of alcohol tobacco and firearms
...View all with 33 letters...
Phrases (37)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicus
...View all with 34 letters...
Phrases (30)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (22)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewii
...View all with 36 letters...
Phrases (22)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeria
...View all with 37 letters...
Phrases (10)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (13)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (11)
minnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance group
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (7)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing