Words Containing: A,E,K,Y
(In Any Order)
There are 546 words,
804 phrases and
0 abbr's with
A,E,K,Y in.
Best Scoring Words With: A,E,K,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| keyways | 7 | 20 | nounn | |||||
noun • A slot into which a precision attachment (a key) is fitted. | ||||||||
| hawkeys | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| hackney | 7 | 19 | noun, adjectiven, adj | |||||
noun • a carriage for hire • a compact breed of harness horse | ||||||||
| hawkey | 6 | 19 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| kayaked | 7 | 19 | verbv | |||||
verb • To use a kayak, to travel or race in a kayak. • To traverse (a body of water) by kayak. | ||||||||
| keyway | 6 | 19 | nounn | |||||
noun • A slot into which a precision attachment (a key) is fitted. | ||||||||
| bikeway | 7 | 19 | nounn | |||||
noun • A bicycle lane or path. | ||||||||
| weekday | 7 | 18 | nounn | |||||
noun • any day except Sunday (and sometimes except Saturday) | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (49)
squeakystarkeybarkleyweekdayhackneykeycardpasskeystreakynakedlyhackeryknaveryvandykescreakyracketykerygmakyanitekeypadsbleaklylackeyskayakedkayakeralkynesraylikekeypalsleakilykyanisekeywayskyanizedarkeysyakkershawkeysbikewaywykehamyslakedbacksey
...View all with 7 letters...
Phrases (11)
eye maskde bakeykey palmeye bankmake hayzeta keyvan eyckmake wayback yerweak yer
...View all with 7 letters...
Words (82)
keyboardpaycheckyearbookdaybreakweekdaysmalarkeyladyliketakeawayyarmulkevalkyrieteriyakimarkedlylatchkeyquackerysneakilyblanketyhaymakerpeacockyhawkeyedfreakilykeffiyahrockabyekaleyardkaffiyehbasketrykeycardslackeyedquaylikekielbasyflackerykayakerskyanisedkyaniseskyaniteskyanized
...View all with 8 letters...
Phrases (14)
easy markkay boylewatch keykeep awaymajor keykorea bayblack eyecape yorkallen keyjay cooke
...View all with 8 letters...
Words (91)
speakeasyreykjavikbreakawaykeynesianjaywalkerplaymakerthackerayhackneyedjayhawkerkaryotypehackberryeukaryotepaycheckswakefullyfairylikeperikaryakaffiyehsskyjackedskylarkerwalkyriesteriyakisankylosedmythmakerkeffiyahskerygmatarockabyesyarmelkesyarmulkeskaleyardsrakehellykeyboardsweakishlygraywackelatchkeyslackeying
...View all with 9 letters...
Phrases (35)
lake nyasalike crazyjockey cappay packetkeep relaysay hey kidmake happybreak awayjack bennyguy fawkes
...View all with 9 letters...
Words (85)
remarkablyblackberrymistakenlyskyscraperbricklayermoneymakerfreakishlyeukaryoticlawyerlikeunladylikeprayerbookdyskinesiamerrymakerlukewarmlygraywackesskylarkerssneakinglyskeletallyjackasserymythmakerskerygmatickeyboardedplaymakersrekeyboardjonnycakeshackneyingperikaryalperikaryonjohnnycakeskyjackersswaybackeddayworkersjayhawkersjaywalkersprokaryote
...View all with 10 letters...
Phrases (53)
mary leakeygenus khayaprayer booktalk turkeyyard markerkey patternjohnny cakelady killergray markethook and eye
...View all with 10 letters...
Words (68)
hypermarketunspeakablyhypokalemiahypokalemicjabberwockykeyboardistmoneymakingmerrymakingskepticallyyastrzemskitalkativelypiggybackedskyscrapersprokaryotesbricklayerskaryogamieskeyboardingmoneymakersdyskinesiasrekeyboardsgimcrackerypaddywackedalkalimetryunhackneyedfactorylikemerrymakerstracklayerskaryologiesjohnnycakesfarkleberryyouthquakeskineticallythanklesslykeyboarderskleptocracy
...View all with 11 letters...
Phrases (50)
louis leakeyhockey coachglossy snakelike royaltypolicy makermackerel skykeep an eye onalkyl halidefunny remarkannie oakley
...View all with 11 letters...
Words (47)
hyperkalemiaholidaymakermoneymakingshyperkinesiaheterokaryonmerrymakingskaryokinetichydrocrackedkeyboardistscytoskeletalunremarkablyrekeyboardedhypermarketsdaydreamlikekymographieshypokalemiaskaryokinesesbackhandedlykaryokinesishydrocrackerkeratoplastykeyboardingsyellow-markedbradykinesiaknowledgablystickybeakedyankee-doodlerevokabilityfairnyticklemockumentaryblackish-greyalkylbenzenegreyish-blackkeynesianismkeratophyres
...View all with 12 letters...
Phrases (60)
backspace keyhockey leaguealben barkleybuckeye statedomesday bookblink of an eyealfred kinseyhackney coachback of beyondhawkeye state
...View all with 12 letters...
Words (34)
marketabilityholidaymakersknowledgeablyrekeyboardingmountebankeryphytoplankterhyperkinesiasheterokaryonsmegakaryocytekindheartedlykinematicallyhydrocrackersbradykinesiasstickybeakingblackberryingfairnyticklesclickety-clackblockheadedlyjawbreakinglyklyuchevskayaremarkabilitydostoyevskianknickknackeryheartbrokenlyunmistakeablykenyapithecussketchabilityostyak-samoyedkinesitherapyprickly-leafedprickly-leavedkeratomycosispsychometrikashockumentaryPhrases (58)
el iskandriyahyakut languagejekyll and hydeturkey buzzardfactory workerdorothy parkerthree kings' dayrichard leakeyanxiety attackchesapeake bay
...View all with 13 letters...
Words (20)
hyperkeratoticphytoplanktersankylosaurusesbreathtakinglyhyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticacknowledgedlymegakaryocyteshydrokineticalblackberry-lilyblackberryingsyekaterinoslavladylikenesseskinematographyPhrases (69)
anthony vandykeemergency brakecapital of kenyablackberry bushskeletal systemdynamic speakerkeynote addressstrawberry markvotyak languageblack raspberry
...View all with 14 letters...
Words (11)
heartbreakinglykinestheticallyankylostomiasestelekineticallyphenylketonuriabrokenheartedlyknowledgabilitycockneyficationkenogeneticallyacknowledgeablylymphoblast-likePhrases (65)
erlenmeyer flaskmask of pregnancycapital of turkeyalfred korzybskisecurity blanketandrei tarkovskymonkey-bread treewilliam mckinleymarketable yieldwilliam shockley
...View all with 15 letters...
Words (6)
heterokontophytakinaestheticallyphenylketonuriasheterokaryosiseskrypterophaneronknowledgeabilityPhrases (48)
strictly speakinghypophyseal stalkcapital of new yorkfriendly takeoverfamily gekkonidaetrackless trolleycreek confederacycoral honeysuckleryukyuan languagecomstock mealybug
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (30)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitjohn fitzgerald kennedythomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemkurdistan workers party
...View all with 21 letters...
Phrases (15)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykoaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamondsayatollah ruholla khomeini
...View all with 24 letters...
Phrases (16)
francis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemia
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
