Words Containing: A,E,I,P
(In Any Order)
There are 16,011 words,
9,663 phrases and
0 abbr's with
A,E,I,P in.
Best Scoring Words With: A,E,I,P
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| piazze | 6 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| pickaxe | 7 | 22 | verb, nounv, n | |||||
noun • a heavy iron tool with a wooden handle and a curved head that is pointed on both ends | ||||||||
| zaptieh | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| baptize | 7 | 20 | verbv | |||||
verb • administer baptism to | ||||||||
| capsize | 7 | 20 | verbv | |||||
verb • overturn accidentally | ||||||||
| apprize | 7 | 20 | verbv | |||||
verb • inform (somebody) of something • make aware of • gain in value • increase the value of | ||||||||
| capizes | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| zappier | 7 | 20 | verb, adjectivev, adj | |||||
adjective • Lively or energetic. | ||||||||
| pyrexia | 7 | 19 | nounn | |||||
noun • a rise in the temperature of the body; frequently a symptom of infection | ||||||||
| epitaxy | 7 | 19 | nounn | |||||
noun • growing a crystal layer of one mineral on the crystal base of another mineral in such a manner that its crystalline orientation is the same as that of the substrate | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (407)
specialexplainprivatepatientvampirepaintedhappierpainterapplieddespairpaulinecaptiveprevailpassivepersianpelicanprairiereplicaleapingpereirabaptizeprimatepastimeimpaledcapricepartiedpinheadrepaintsapiensbaptiseepitaphimpassespanielpillageprepaid
...View all with 7 letters...
Phrases (17)
pine tarphase inraise upbean dipwild peameat piesea pinkpig leadphase iiphase iv
...View all with 7 letters...
Words (915)
speakingpracticepatheticparadisepatienceairplaneappetiteimperialegyptianhappiestescapingpractisepeculiarpanickedparticleparasitebaptizedethiopiapleasingpainlesspleadingemphasiscampfireappendixcampsiteplaytimeepiphanyephesianperuvianpizzeriaadoptiveimpairedprivatesairspacesapphire
...View all with 8 letters...
Phrases (53)
pipe rackpia materpecan piewipe awayin spadespis allertrap linepeach pitprice tagtime plan
...View all with 8 letters...
Words (1626)
happeningapologizeoperationhappinessdisappearkidnappedpotentialpolicemanpreparingoperatingapologisespreadingtherapistspeciallyappointedsingaporespecialtyacceptingspaghettirepeatingpracticedimpatientspaceshipincapablekidnapperprivatelyfireplacepineapplevideotapepneumoniapalestineappearingreplacingoperativepreaching
...View all with 9 letters...
Phrases (134)
plant lifebean aphidpast timesdisk shapepipe dreamgenus apisedith piafdirt cheapbriar pipepike's peak
...View all with 9 letters...
Words (2095)
especiallyappreciatereputationoperationsimportancepassionatespecialistseparationparliamentleadershiptemptationaccomplicerepublicanmanipulateapprenticeapologizeddespicableprofitableseparatingcompatiblepilgrimagecomplicateprecautionanticipatedisposablejeopardizeimperativeproclaimedimpeccablepersuasivegrapefruitspecialitysympathizespecializebirthplace
...View all with 10 letters...
Phrases (237)
navel pointprivate eyepast simplejohn napierspecial actwild peanutbitter sparmagic spellfield pansyapple aphid
...View all with 10 letters...
Words (2473)
complicatedappointmentexplanationpersonalityappropriateparticipatecooperationmasterpieceappreciatedpreparationtemporarilyexceptionalpartnershippalestinianhandicappedpreliminaryaccompaniedpotentiallypredictabletrespassingsympatheticmanipulateddesperationsuperficialoperationalspeculationcooperativeanticipatedexplorationoverlappingspecializedexpectationprovocativeproblematicinseparable
...View all with 11 letters...
Phrases (377)
prairie wolfrubbish heapclass periodpartial veilsurface shipbitter pecanprivate linespace writerplaying areaspecial jury
...View all with 11 letters...
Words (2350)
relationshipprofessionaldisappointedspecificallypresentationaccomplishedphiladelphiapresidentialcompensationdisappearingexperimentalappreciationpennsylvaniametropolitanhospitalizedparticipatedexploitationpassionatelypenitentiaryincorporatedpreservationsleepwalkingencyclopediamanipulativehypotheticalimpenetrableinexplicablepediatricianpremeditatedmetaphysicaldisplacementalphabeticalemancipationappreciativepractitioner
...View all with 12 letters...
Phrases (542)
pole vaultingabelian grouplouis pasteurczech capitalstaying powerspace vehicleperoneal veinpaul verlainestar sapphiregenus primula
...View all with 12 letters...
Words (2114)
approximatelysophisticatedinappropriatedisappearanceunpredictablecompassionateschizophreniaexceptionallyeavesdroppingcontemplatingindispensableirreplaceableappropriatelycomplimentaryimpersonatingmetamorphosiscontraceptionparliamentaryincapacitateduncomplicatedpreliminariesprecautionarycontemplationunexplainablepredominantlyexponentiallyproliferationparaphernaliacontraceptivephysiotherapyprecipitationimpersonationteleportationhermaphroditeaccompaniment
...View all with 13 letters...
Phrases (705)
partial breachpaul hindemithcartridge clipdelphic oraclefelis pardalisplant materialprunus persicafamily picidaepentanoic acidpontius pilate
...View all with 13 letters...
Words (1604)
representativedisappointmentinterpretationpharmaceuticalrepresentationprofessionallyunprofessionalhypotheticallyaccomplishmentcinematographyconstantinoplemetaphoricallyimplementationapprenticeshipimpressionableantidepressantcontemporariesrespectabilityunpremeditatedgeographicallyalphabeticallyoverpopulationinterplanetaryspecializationelectroplatingpaleontologisthyperventilateindecipherablewhippersnapperpredictabilityreimplantationdepigmentationpredestinationexperimentallybenzodiazepine
...View all with 14 letters...
Phrases (806)
family apiaceaeimperative formalpine clubmossimperative moodpearl mae baileyamphibole groupimperative verbneutral spiritsprivate citizenarterial plaque
...View all with 14 letters...
Words (1176)
cinematographerprofessionalismexperimentationpsychotherapistmethamphetaminepithecanthropuspersonificationentrepreneurialinappropriatelyunsophisticatedspermatogenesisphysiotherapistunsportsmanlikemisapprehensionparthenogenesissympathomimeticdolichocephaliccinematographicparentheticallyplenipotentiaryappropriatenessnonprofessionalconceptualizingproportionatelytherapeuticallypalaeontologistcompassionatelyuncomplimentarymethylphenidatenonexperimentalpostoperativelyunparliamentaryprestidigitatorjurisprudentialunacceptability
...View all with 15 letters...
Phrases (913)
malaria parasitepanel discussioniridaceous plantcapital of francedame muriel sparkfalco peregrinusalimentary pastecapital of greecegenus potentillasingapore dollar
...View all with 15 letters...
Words (450)
disproportionateaustralopithecusprestidigitationtriphenylmethanerepresentationalunpredictabilitycounterespionagehyperventilationchemotherapeuticphylogeneticallyreinterpretationpharmaceuticallyovercompensationovercomplicatinginterpretationalunapologeticallypalaeontologicalepiphenomenalismthrombocytopeniapredeterminationcompartmentalizeunprofessionallyanthropomorphiseanthropomorphizeacquaintanceshipnonproliferationneuropsychiatricnorthamptonshirehypersalivationsnonmetropolitansparadoxicalitieslepidodendraceaespectroheliogramparamagneticallyparameterization
...View all with 16 letters...
Phrases (902)
tympanic membranemultiengine planeatopic dermatitisprofessional lifestrictly speakingcapital of georgianeritid gastropodperfective aspectdelphinium ajacisgenus angiopteris
...View all with 16 letters...
Words (310)
depersonalizationmisinterpretationimmunosuppressantmisrepresentationcompartmentalizedparathyroidectomycardiorespiratorytriskaidekaphobiacompartmentalisedinappropriatenesspsychotherapeuticdextroamphetamineinterrelationshipinterdisciplinaryinterdepartmentalhyperreactivitiesradioautographiesantischizophreniaantischizophrenicparadoxicalnessesphysiotherapeuticcercidiphyllaceaespectroheliogramsspectroheliographkaleidoscopicallyleukoencephalitisparameterizationsprivate-enterpriseparaprofessionalshyperstimulationsmisrepresentativeradiotelegraphiesspectroscopicallyhyperventilationsnonprofessionally
...View all with 17 letters...
Phrases (921)
capital of ethiopiagopherus agassiziimary leontyne pricecompetence hearingpontederia cordatagenus globicephalasalvia leucophyllaclomiphene citratelandscape paintingacherontia atropos
...View all with 17 letters...
Words (162)
disproportionatelycompartmentalizinghypercoagulabilityoversimplificationhyperaldosteronismoverrepresentationneuropsychologicalpaleoclimatologistinexpugnablenessespolyesterificationhypersensitizationspectroheliographsmisinterpretationsspectroheliographythermoplasticitiesmisrepresentationsunpredictabilitiesinhospitablenessesunprofitablenessesappreciativenessespsychotherapeuticsapprehensivenessescompanionabilitiessphygmomanometrieslepidopterologicalcompartmentalisingpostmillenarianismhyposensitizationspostmillennialismsanthropocentricitynonrepresentativespostmillennialistsrechromatographiesrechromatographinglipopolysaccharide
...View all with 18 letters...
Phrases (787)
professional golfererinaceus europaeusrevolutionary groupheat of vaporisationtuamotu archipelagoheat of vaporizationfamily physeteridaeprivate corporationeriobotrya japonicaandromeda polifolia
...View all with 18 letters...
Words (120)
hyperparathyroidismpseudohermaphroditecinematographicallypolyesterificationshypersensitizationsprofessionalisationprofessionalizationparathyroidectomieshypolipoproteinemiaparthenogeneticallycompanionablenessesdispassionatenessespostmillenarianismscompassionatenessesencephalomeningitismucopolysaccharidescomplementarinesseslipopolysaccharidesreconceptualizationdisrespectabilitiesstereophotographiesresorcinolphthaleinconceptualisticallycytopathogenicitiesperspicaciousnessesbacteriochlorophyllphenomenalisticallytransplantabilitiesgedankenexperimentsphenylthiocarbamideprefigurativenessesimmunoprecipitatingimmunoprecipitationpseudohallucinationelectrocardiographs
...View all with 19 letters...
Phrases (727)
water-plantain familyfavourable receptionerinaceus europeaeusallium cepa viviparumfamily cyclopteridaeallium schoenoprasumalpine type of glacierphytolacca americanafamily lepisosteidaepellaea rotundifolia
...View all with 19 letters...
Words (63)
compartmentalizationhypercholesterolemiaparadichlorobenzenessemiautobiographicalspectroheliographiesradiopharmaceuticalsspectrophotometricalparathyroidectomizedabetalipoproteinemiaunrepresentativenessreconceptualizationshyperadrenocorticismbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesimmunoprecipitationspseudohermaphroditicoophorosalpingectomyphosphatidylcholinesadrenocorticotropinsneuropharmacologicalphosphofructokinasesneuropharmacologistsneurophysiologicallyrepresentationalismsrepresentationalistsneuropsychiatricallyhyperlipoproteinemiarepresentativenessesadrenocorticotrophicadrenocorticotrophinelectrooculographiesphotodisintegrationselectrophotographiesprofessionalizations
...View all with 20 letters...
Phrases (541)
allium cepa aggregatumblack-capped chickadeeappendicular skeletonwyethia amplexicaulispara aminobenzoic acidprofessional relationfamily phytolaccaceaephotographic emulsionpast progressive tensesir karl raimund popper
...View all with 20 letters...
Words (17)
hypogammaglobulinemiacompartmentalizationsstereomicroscopicallyelectrocardiographiespseudohermaphroditismadrenocorticotrophinsmeningoencephalitideselectromyographicallyelectroretinographiespolyvinyl-formaldehydepseudocholinesterasesarenaria-melanocephalapseudosophisticationshypercholesterolemiaspsychotherapeuticallycounterinterpretationunexceptionablenessesPhrases (474)
experimental conditioncercopithecus aethiopsgasterosteus pungitiushelianthemum scopariumanaphalis margaritaceadiametrical oppositionbureaucratic procedurephilosophical doctrinespontaneous generationtelephone conversation
...View all with 21 letters...
Words (7)
spectrophotometricallyunrepresentativenessesnonrepresentationalismelectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninecounterinterpretationsPhrases (345)
prunus persica nectarinahaliaeetus leucorhyphusposterior nasal apertureredevelopment authorityequal-area map projectionfamily dendrocolaptidaemultiple mononeuropathypeloponnesian peninsulacapital of liechtensteinsodium tripolyphosphate
...View all with 22 letters...
Words (3)
electroencephalographicnonrepresentationalismshypobetalipoproteinemiaPhrases (254)
parenthetical expressiontribasic sodium phosphateposterior pituitary glandchlorpheniramine maleateto all intents and purposesarchibald percival wavellsubpoena ad testificandumyellowstone national parkparis-sorbonne universitypharmacological medicine
...View all with 23 letters...
Words (6)
microgramma-piloselloideshyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographiesmicroelectrophoreticallyPhrases (202)
professional organisationprofessional organizationpelham grenville wodehouseargyroxiphium sandwicensedivision heterokontophytaprivately held corporationtrip the light fantastic toecapture of fort ticonderogaprimary sex characteristicbattle of the philippine sea
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (148)
count ferdinand von zeppelinmyroxylon balsamum pereiraemusculus quadriceps femorischemical weapons conventioncruel and unusual punishmenttherapeutic rehabilitationfast local internet protocolboris leonidovich pasternakwar of the spanish successionproprietorship certificate
...View all with 25 letters...
Phrases (121)
charlotte anna perkins gilmanchannel islands national parkshort-spurred fragrant orchidsir sarvepalli radhakrishnanpolicing and enforcement costalternanthera philoxeroideslassen volcanic national parkmalignant neoplastic diseaseadrenocorticotropic hormonepersonal information manager
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (75)
partial differential equationholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanaadrenocorticotrophic hormonedeoxyadenosine monophosphatesocial development commissiontricyclic antidepressant drug
...View all with 27 letters...
Phrases (72)
revolutionary people's strugglebureau of engraving and printingephippiorhynchus senegalensiscardiopulmonary resuscitationmicrosoft disk operating systemthird council of constantinoplecapital of serbia and montenegrodemocratic republic of the congodepartment of homeland securitydissident irish republican army
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (58)
business interruption insurancesecond council of constantinoplechemical decomposition reactionantisocial personality disordermale internal reproductive organdisorganized type schizophreniaautomatic data processing systemcapital of the dominican republicgiovanni pierluigi da palestrinacapital of the russian federation
...View all with 29 letters...
Phrases (41)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionvicomte ferdinand marie de lessepsrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (34)
united states public health servicegreat smoky mountains national parksecond epistle to the thessalonians2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementunited states trade representativerevolutionary proletarian nucleus
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (23)
people against gangsterism and drugspatent and trademark office databaseweakly interacting massive particlestraight-line method of depreciationobject-oriented programing languagecercopithecus aethiops pygerythrusprimary subtractive colour for lightinsulin-dependent diabetes mellituscockcroft-walton voltage multiplierwilhelm apollinaris de kostrowitzki
...View all with 32 letters...
Phrases (22)
autonomous sensory meridian responsestandard generalized markup languageepistle of paul the apostle to philemonlycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi pedisorganization of the oppressed on earthpityrogramma calomelanos aureoflavanondepository financial institutionprivilege against self incrimination
...View all with 33 letters...
Phrases (18)
chronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansgeorge louis palmella busson du mauriermusculus sphincter ductus pancreaticieuropean law enforcement organisationvena centralis glandulae suprarenalisdryopithecus rudapithecus hungaricusprince otto eduard leopold von bismarckfederal deposit insurance corporation
...View all with 34 letters...
Phrases (21)
johann christoph friedrich von schillerinternational development associationunited states postal inspection servicerevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sadeimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathycockcroft and walton voltage multiplier
...View all with 35 letters...
Phrases (12)
center for disease control and preventionnational geospatial-intelligence agencyfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiitransportation security administrationnatural language processing applicationsocialist people's libyan arab jamahiriyavenae dorsales clitoridis superficialesdeclining balance method of depreciationpublius cornelius scipio africanus major
...View all with 36 letters...
Phrases (17)
first epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccine
...View all with 37 letters...
Phrases (7)
second epistle of paul the apostle to timothydemocratic republic of sao tome and principemarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityepistle of paul the apostle to the colossiansminimally invasive coronary bypass surgeryPhrases (9)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicislamic jihad for the liberation of palestinerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestineepistle of paul the apostle to the philippiansPhrases (9)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleiprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisrussian soviet federative socialist republicfirst of october antifascist resistance grouptrillion floating point operations per second
