Words Containing: A,E,I,K,N,S
(In Any Order)
There are 833 words,
1,029 phrases and
0 abbr's with
A,E,I,K,N,S in.
Best Scoring Words With: A,E,I,K,N,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
hankies | 7 | 14 | nounn | |||||
noun • a square piece of cloth used for wiping the eyes or nose or as a costume accessory | ||||||||
kyanise | 7 | 14 | ||||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
kinemas | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
sinkage | 7 | 12 | nounn | |||||
noun • An amount of material involved in a sinking. • An area of sunken ground; a depression. • The change in draft that a vessel obtains when moving through the water. | ||||||||
intakes | 7 | 11 | verb, nounv, n | |||||
noun • the process of taking food into the body through the mouth (as by eating) • an opening through which fluid is admitted to a tube or container • the act of inhaling; the drawing in of air (or other gases) as in breathing | ||||||||
kinases | 7 | 11 | nounn | |||||
noun • an enzyme that catalyzes the conversion of a proenzyme to an active enzyme | ||||||||
alkines | 7 | 11 | nounn | |||||
Valid word for Scrabble US
| ||||||||
snakier | 7 | 11 | adjectiveadj | |||||
adjective satellite • resembling a serpent in form | ||||||||
kinase | 6 | 10 | nounn | |||||
noun • an enzyme that catalyzes the conversion of a proenzyme to an active enzyme | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
kinaseWords (55)
speakingmistakensneakingskinheadsealskinbearskinbanksidesneakilybeatniksskincareswankiersneakiersandlikeskankierramekinsswanlikeskiplanelinkageskaiserinneatnikssnakiestlankiestsnarkierranpikeskyanisedunakiteskyaniseskyaniteskyanizestwankiescakinessikebanaskaolineskeratinssinkable
...View all with 8 letters...
Phrases (5)
wine caskheat sinksnake oilsnake pitskin careWords (104)
squeakingskinheadsswankiestashkenazisnakeskinkeynesiansnakebiteshrinkagespinnakerwackinesswaterskincrankiestgawkinesstackinessflakinesssnakelikesneakiestspikenardalikenessshakinesssaintlikekidnapersweaklingsnicknamesquakinessninebarkswakeningslankinesscasketingbalkinessknaverieslarkinessclankiestkaiserinsleakiness
...View all with 9 letters...
Phrases (15)
ant shrikemake noisepine snakecase knifeking jamesking snakesaint lukeink erasermilk snaketake pains
...View all with 9 letters...
Words (131)
mistakenlyuzbekistanunsinkabledickensianslackeningsneakinessnoisemakerbespeakingfreakinesscrankinessdyskinesiashoemakingseamanlikerakishnessantinukersriverbankskidnappeeskidnappersnicknamersswankinessspinnakersenokitakeskaoliniteskeratinouskarabinerssneakinglydrinkableshandspikesunspeakingshrinkageshankeringsrestackingbalkanizeswinemakerspresoaking
...View all with 10 letters...
Phrases (31)
skiing racesneak thiefking's spearclasp knifekauri resinsteak knifein darknesssnake rivergenus kogiastalin peak
...View all with 10 letters...
Words (142)
safekeepingcandlestickseasicknessdressmakingmawkishnesskinesthesiamisspeakingcarsicknesssteelmakingairsicknessshellackingawestrickenplainspokenspinachlikeringstrakedshakinessescandlewicksprintmakersnonsinkableskedaddlinglikablenessflakinessesgawkishnesssoundalikesstickhandleglucokinasenonspeakingleakinesseshexokinasesmarlinspikebacksliddendyskinesiaswaterskiingquakinessesoutspeaking
...View all with 11 letters...
Phrases (57)
nikola tesladrain basketelapid snakegenus krigiaair sicknessribbon snakegenus okapiaanise cookiedanish kroneskin disease
...View all with 11 letters...
Words (150)
frankensteinsleepwalkingunmistakablethessalonikijacksonvillespeechmakingfrankincensepackinghouseturkmenistanheadshrinkerearthshakingstakhanovitestickhandledstickhandleskleptomaniasmoneymakingshyperkinesiadisembarkingenterokinasesidetrackingdamaskeeninglinebackingsdebarkationslawbreakingscandlesticksphrasemakingcrankinesseswindbreakersundertakingsmerrymakingsalkalinitieskitchenwareswisecrackingbreakfastingcabinetworks
...View all with 12 letters...
Phrases (53)
francis drakegenus makairaalaska nativemasking papermasking pieceraisin cookiewake-up signalskin and bonesalfred kinseystock-in-trade
...View all with 12 letters...
Words (107)
skateboardingsportsmanlikestreetwalkinghousebreakinganticlockwisetalkativenessstatesmanlikestreptokinaseshakespearianunmistakeablekleptomaniacsmetalworkingsheadshrinkershandkerchiefslikablenesseskindergartenscabinetmakerscraftsmanlikestickhandlershyperkinesiasfrankincensespeacekeepingswakeboardingsstreakinessesmarlinespikesairsicknessesbankabilitiesnonshrinkablebenchmarkingsgreenbackismsphrasemakingssafecrackingsmawkishnesseshawkishnessesbackcountries
...View all with 13 letters...
Phrases (69)
bakke decisionel iskandriyahbabe didriksonsurgical knifebenjamin spockroller skatingthree kings' dayeast pakistaniaxial skeletonspitting snake
...View all with 13 letters...
Words (53)
disembarkationhousebreakingstroublemakingscabinetmakingssemidarknessesbackscatteringbrackishnessesearthshakinglyprankishnessesstrikebreakingthrombokinasesskateboardingshandkerchievesstreetwalkingsdrinkabilitiestelemarketingsfreakishnessesstreptokinaseskindergartnersspokesmanshipspanleukopeniasphosphokinasesgallsicknessesmarketisationsdisembarkmentsblackberryingsmarketizationsmockumentariessneakingnessesconstablewickssneakishnessesturkic-speakingharlequin-snakelikeablenessesyekaterinoslav
...View all with 14 letters...
Phrases (79)
kissing diseasesir joseph banksstephen hawkingchicken scratchstinking wattledynamic speakerskilled workmantake a firm standpakistani rupeedecision making
...View all with 14 letters...
Words (49)
unsportsmanlikeczechoslovakiankindheartednesskinestheticallyplainspokennessstraitjacketingankylostomiasesbackscatteringsstrikebreakingsleukaemogenesisdisembarkationskeratinizationsunworkabilitiesunknowabilitiesmountebankeriesthinkablenesseskindergartenersheartsicknessestalkativenessesthankworthinessmicromarketingscontraclockwiseitalian-speakingunstatesmanlikechicken-breastedkind-heartednessthickheadednesskeratinisationssemitic-speakingpainstakingnesskannada-speakinggroundbreakingsbrainsicknessesspanish-speakingenglish-speaking
...View all with 15 letters...
Phrases (86)
koasati languagepinchas zukermansnake in the grassattack submarineinsurance brokerturkish languagehorseback ridingniels henrik abelsteering linkagegenus rickettsia
...View all with 15 letters...
Words (8)
unthinkabilitieskinaestheticallypharmacokineticsphenylketonuriasprekindergartensjapanese-speakingwrinkle-resistantlivonian-speakingPhrases (84)
strictly speakingaleksandr borodincaptain james cookalexander pushkinalexander selkirkismoil somoni peakdisease of the skinnooks and cranniessoren kierkegaardbank commissioner
...View all with 16 letters...
Words (8)
leukoencephalitiskindheartednessesicelandic-speakingstraightjacketinggentlemanlikenesssamoyedic-speakingthreskiornithidaeplainspokennessesPhrases (65)
kiswahili languagenikolaas tinbergenaleksandr scriabincapital of nebraskaabkhasian languagebeefsteak geraniumburning at the stakesubkingdom metazoavirginia snakeroothook line and sinker
...View all with 17 letters...
Words (3)
gedankenexperimentsgentlemanlikenessesphosphofructokinasePhrases (57)
meat-packing businesshandle with kid glovesvalentina tereshkovaanti-takeover defensegerard manley hopkinsdibranchiate mollusktrans-alaska pipelinemickey charles mantlebaroness karen blixenignace jan paderewski
...View all with 19 letters...
Words (3)
keratoconjunctivitesphosphofructokinaseskeratoconjunctivitisPhrases (58)
appendicular skeletonwilliam wilkie collinssir karl raimund popperuniversity of nebraskarepublic of kazakhstanernst heinrich haeckelmechanically skillfulhendrik petrus berlagefrankenstein's monstereastern turki language
...View all with 20 letters...
Words (2)
keratoconjunctivitideskeratoconjunctivitisesPhrases (34)
aleksandr i. solzhenitsynsir laurence kerr olivierjohn davison rockefellerjan evangelista purkinjecharlotte perkins gilmanpearl sydenstricker buckblack-fronted bush shrikeeverglades national parkarchidiskidon imperatordiamondback rattlesnake
...View all with 22 letters...
Phrases (20)
division heterokontophytarichard buckminster fullercharles john huffam dickensmax karl ernst ludwig planckhashemite kingdom of jordanfrancis henry compton crickbenjamin franklin norris jr.counterclockwise rotationislamic group of uzbekistanketosis-resistant diabetes
...View all with 24 letters...
Phrases (22)
cosmic microwave backgroundfrancis scott key fitzgeraldboris leonidovich pasternakrudolf christian karl dieselsaddam bin hussein at-takrititrans-alaska pipeline systemcharles frederick menningerandrei arsenevich tarkovskybronislaw kasper malinowskipodkamennaya tunguska river
...View all with 25 letters...
Phrases (15)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parksir sarvepalli radhakrishnanlassen volcanic national parkemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovjohannes diderik van der waalsunited mine workers of america
...View all with 26 letters...
Phrases (28)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkindirector-stockholder relationjerusalem artichoke sunflowertaras grigoryevich shevchenkoaleksandr aleksandrovich blokfalkland islands monetary unitnikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritance
...View all with 27 letters...
Phrases (14)
aleksandr feodorovich kerenskystrategic arms limitation talksmicrosoft disk operating systemsergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakuninmildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevkaposi's varicelliform eruption
...View all with 28 letters...
Words (1)
hexakosioihexekontahexaphobiaPhrases (9)
aleksandr nikolayevich scriabinkatmai national park and preservetheodore roosevelt national parkketoacidosis-resistant diabetesgrigori aleksandrovich potemkinalfred habdank skarbek korzybskiteodor josef konrad korzeniowskiwestern diamondback rattlesnakedenali national park and preservePhrases (11)
nikolai andreyevich rimski-korsakovpatent and trademark office databaseweakly interacting massive particlesergei aleksandrovich koussevitzkycount nikolaus ludwig von zinzendorfnikolai andreyevich rimsky-korsakovuniversity of california at berkeleyketosis-resistant diabetes mellitusyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzki
...View all with 32 letters...