Words Containing: A,E,H,S,S
(In Any Order)
There are 5,006 words,
3,202 phrases and
0 abbr's with
A,E,H,S,S in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| quashes | 7 | 19 | verbv | |||||
verb • put down by force or intimidation • declare invalid | ||||||||
| samekhs | 7 | 16 | nounn | |||||
noun • the 15th letter of the Hebrew alphabet | ||||||||
| cashews | 7 | 15 | nounn | |||||
noun • tropical American evergreen tree bearing kidney-shaped nuts that are edible only when roasted • kidney-shaped nut edible only when roasted | ||||||||
| shakers | 7 | 14 | nounn | |||||
noun • a celibate and communistic Christian sect in the United States | ||||||||
| schemas | 7 | 14 | nounn | |||||
noun • an internal representation of the world; an organization of concepts and actions that can be revised by new information about the world • a schematic or preliminary plan | ||||||||
| sachems | 7 | 14 | nounn | |||||
noun • a political leader (especially of Tammany Hall) • a chief of a North American tribe or confederation (especially an Algonquian chief) | ||||||||
| shakoes | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shammes | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| swashed | 7 | 14 | verbv | |||||
noun • the movement or sound of water verb • make violent, noisy movements • dash a liquid upon or against • show off • act in an arrogant, overly self-assured, or conceited manner | ||||||||
| samechs | 7 | 14 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (261)
harmlessharassedheadlessemphasissquashedshowcaseseashoreshamblessplashedhairlessshakiesthardnessseashellgalosheschasseurchastiseseahorsesquashesthessalyharasserhandlessshamisenrashnessstarcheslachesishasheeshsenhorassawhorsesharpiespathlesschessmanesthesiasplashersunshadehaleness
...View all with 8 letters...
Phrases (9)
sea horsemess hallsea chestirish seasash linecase shotsouth seadress hatgas shellWords (485)
happinessestablishshamelessheartlessspaceshipsoutheastscratchesskinheadssqueamishfaithlesssaphenousesophagusaegisthusharnessednewsflashshipshapethanklesssharpnessemphasiseheaddressshapelessmisshapensweatshopheavinessthesaurusmatchlessharshnesshumannesswhereasesspearfishsagebrushsteamshipauthoresschastisedseneschal
...View all with 9 letters...
Phrases (26)
hash housedisk shapeamish sectchess gameset ashoresafe housepush asidestay freshsilver ashfish scale
...View all with 9 letters...
Words (680)
enthusiasmharassmentbreathlessastonisheddishwasheranesthesiasweatshirtwarehousesaestheticssteakhouseenthusiasthephaestusfatherlesschessboardhoarsenesshandsomestsympathiseshadowlesssoothsayerantithesiswheatgrasshemostasisgarishnesshandednesssousaphoneplayhouseschangelessflashinessharmlesslyoesophagusapotheosisstatehousefarmhousesbushmasterseamanship
...View all with 10 letters...
Phrases (56)
sales boothelisha otissam shepardshish kebabgenus aphisgenus physamarsh cresschess matchgenus hostapost chaise
...View all with 10 letters...
Words (758)
establishedshakespearehairdresserunhappinessgrasshopperhorseradishshamelesslyblasphemousanaesthesiametaphysicsreestablishenchantresstallahasseestewardshipnaughtinesshousemasteranesthetistsynesthesiaparenthesisspreadsheethomeostasisseismographmarchionessguardhousesphosphataseshallownessscattershotsympathisersympathisedhealthinessheartlesslyarchduchessmawkishnessesophagitisstealthiest
...View all with 11 letters...
Phrases (81)
great schismsurface shipsensory hairgenus phaiusgenus pholassouth by easthorse balsameast by southanise hyssopgenus raphus
...View all with 11 letters...
Words (723)
enthusiasticheadmistresshairdressingastonishmentstratospherethessalonikifaithfulnessschoolmastersoutheasternheartstringssharpshootercalisthenicsbreathlesslyanaestheticsgamesmanshipanaesthetistaristophanespsychosexualsalesmanshipsaskatchewansophisticatealmightinesshorsemanshiphandsomenessthankfulnessswashbuckleraestheticismtransshippedwatchfulnesssnappishnessslaughterousanaesthetiseoveremphasishelmsmanshipstraightness
...View all with 12 letters...
Phrases (130)
space shuttlesausage houndstar sapphirechinese anisegenus xiphiasgenus arachishunter's saucesash fastenerspanish heathmass hysteria
...View all with 12 letters...
Words (659)
sophisticatedestablishmentmassachusettsmetamorphosischristmastimeshakespeareanhorsefeathersshamelessnesscharacterlessmetamorphosessteeplechaserstratosphericthoracentesistransshipmentsoutheasterlyfaithlessnessloathsomenesschangefulnesselephantiasispsychoanalyseblandishmentsheartlessnessseismographicleishmaniasisshakespearianpigheadednessstatesmanshipsqueamishnesssaccharomyceshonorablenesshabitablenessdisfranchisedsoutheastwardhaphazardnesshematopoiesis
...View all with 13 letters...
Phrases (162)
white asbestosgenus anthemistreasure chestchristmas cakefeast of boothsos scaphoideumearth's surfacechristmas treesir thomas morefounders' share
...View all with 13 letters...
Words (549)
slaughterhousecholinesteraseunfaithfulnessbreathlessnessnarcosynthesisbullheadednessosteoarthritisunenthusiasticheadmastershipdisenfranchisemechanicalnessunthankfulnesshospitablenessfarsightednessanesthesiologyservomechanismhippopotamuseschangelessnessomphaloskepsisshamefacednessunchangingnessopenhandednessoutlandishnessmethodicalnesschangeablenessphosphorylatesboneheadednessreestablishingadhesivenesseshemerocallisesheadmistressesschoolteachershardheadednesssoutheastwardsdehydrogenases
...View all with 14 letters...
Phrases (206)
anthony burgesssir joseph bankschanson de gestegaston lachaisefisherman's luresagebrush stateclass thaliaceafrancis joseph ichristmas bellsacross-the-board
...View all with 14 letters...
Words (381)
psychotherapistunsophisticateddisenfranchisedanaesthesiologyphysiotherapistmisapprehensionparthenogenesisinterscholasticdistinguishablelightheadednessnearsightednessatherosclerosisunderhandednesssubstratospherekindheartednesssoftheartednessadenohypophysisdownheartednessblameworthinesswarmheartednesscoldheartednessstandoffishnessreproachfulnessblasphemousnessaccomplishmentstreacherousnessreestablishmentschoolmasterishschematizationslevelheadednesschangefulnessestrisoctahedronsswellheadednessdeathlessnessesunderemphasizes
...View all with 15 letters...
Phrases (293)
high renaissancedialysis machineacheta assimilishyoscyamus nigergenus anthocerossnake in the grassacross the nationscholarly persongenus charadriusii thessalonians
...View all with 15 letters...
Words (136)
enthusiasticallyanesthesiologistaustralopithecuserythroblastosisoverenthusiasticlightheartednessgastroesophagealhypersalivationsradiochemistriesdisenfranchisinghypersexualitiespraiseworthinessparapsychologiesparasympatheticsapocryphalnesseslargeheartednessthreadbarenesseshypervitaminosesfarfetchednessesfarsightednessesglossopharyngealfashionabilitiesfathomlessnessesarchiepiscopatesstadtholdershipsmuddleheadednesslongheadednessesimperishablenessforehandednessesnortheasternmoststeprelationshipwholeheartednessstretchabilitieslymphangiectasisreestablishments
...View all with 16 letters...
Phrases (280)
w. somerset maughamchristian huygensgenus crotaphytushelianthus annuusfestival of lightsbattle of rossbachchemical analysishypophyseal stalkgenus chaenomelesacross the country
...View all with 16 letters...
Words (87)
indistinguishablespectroheliogramskindheartednessesdisestablishmentshyperstimulationsdisfranchisementsinheritablenessesthermostabilitiessphygmomanometerscrashworthinessesfashionablenessesarchconservativespathophysiologieshyposensitizationtenderheartednesslevelheadednessesstandoffishnessesphilosophicalnesscrystallographerscrystallographiesmachine-accessiblecyclophosphamidesauthoritativenesspharisaicalnessesdownheartednesseswarmheartednessesopenheartednessesnearsightednessestreacherousnesseswrongheadednessesacquaintanceshipsglossopharyngealsbiostratigraphiesimperishabilitiesorthopsychiatries
...View all with 17 letters...
Phrases (328)
gopherus agassiziipast-tense morphemehashimoto's diseaseclass rhodophyceaejacques tatischeffgenus symphalangusbureau of the censustheological systemerithacus svecicusprimary censorship
...View all with 17 letters...
Words (55)
hyperaldosteronismdisenfranchisementhypersensitizationspectroheliographsthermoplasticitiesinharmoniousnessesinhospitablenessesdishonorablenessesfaintheartednesseslargeheartednessespsychotherapeuticsapprehensivenessessphygmomanometriesarchaeoastronomieshyposensitizationslightheartednessesmuddleheadednessesastrophotographersastrophotographiespraiseworthinessesaustralopithecinesstoutheartednessesbacteriorhodopsinsrehospitalizationsweatherproofnessescharacteristicnessdehydrochlorinasesorganophosphorusesmechanochemistriesimperishablenessesphosphodiesterasestriskaidekaphobiasphosphoglucomutasegreatheartednessesneuropsychiatrists
...View all with 18 letters...
Phrases (272)
mount rushmore statetheodosius the greatclass schizomycetessir martin frobishersir matthew flindersgenus encephalartosstar-shaped fortresspolianthes tuberosanational censorshiplepomis macrochirus
...View all with 18 letters...
Words (25)
straightforwardnessdisenfranchisementshypersensitizationsmucopolysaccharideslipopolysaccharidesstereophotographiesauthoritativenessesimmunohematologistsphosphofructokinasephosphoglucomutasesphosphomonoesterasecontradistinguishedcontradistinguisheshysterosalpingogramhemidemisemiquaversanticholinesterasesphotoreconnaissancepseudosophisticatedphotosensitizationsestablishmentariansinterchangeablenesstenderheartednessesunfashionablenessesinexhaustiblenessesschizosaccharomycesPhrases (219)
hydrastis canadensisallium schoenoprasumgiles lytton stracheyshakespearean sonnetgenus cryptobranchusgenus symphoricarposhelianthus tuberosustube-shaped structurepounds per square inchavogadro's hypothesis
...View all with 19 letters...
Words (25)
overenthusiasticallyspectroheliographieslymphogranulomatosesdistinguishabilitiesacetylcholinesterasephosphatidylcholinesphosphoenolpyruvatesphosphofructokinasesneuropharmacologistsphosphomonoesterasesphotodisintegrationshistocompatibilitiespseudocholinesteraseantiestablishmentismpseudoparenchymatousphotoreconnaissancespseudosophisticationpsychopharmacologiesnephroangiosclerosisdimethylnitrosaminesheterobasidiomycetespaleoanthropologistsirreproachablenesseshyperparathyroidismsmischaracterizationsPhrases (197)
gilbert charles stuartabelmoschus moschatusbalaenoptera physalusbusiness relationshipbalance sheet analysissagittarius the archersphenisciform seabirdneisseria gonorrhoeaecantharellus cibariuspoor man's weatherglass
...View all with 20 letters...
Words (10)
disestablishmentarianstraightforwardnessesestablishmentarianisminterchangeablenessesacetylcholinesterasespseudohermaphroditismpseudocholinesterasespseudosophisticationshypercholesterolemiasindistinguishablenessPhrases (179)
sir john everett millaisabelmoschus esculentushead and shoulders abovefrances hodgson burnettcercopithecus aethiopsaleksandr solzhenitsynanthriscus cereifoliumanigozanthus manglesiitransmission mechanismsmallmouthed black bass
...View all with 21 letters...
Words (5)
disestablishmentariansphosphoglyceraldehydesencephalomyocarditisesestablishmentarianismsindistinguishabilitiesPhrases (157)
haliaeetus leucorhyphusschlumbergera truncatusleishmaniasis americanaaleksandr i. solzhenitsynaccessory before the factviola tricolor hortensissodium tripolyphosphatebattle of the bismarck searhythm and blues musiciangastroesophageal reflux
...View all with 22 letters...
Words (2)
carboxymethylcellulosesindistinguishablenessesPhrases (106)
parenthetical expressiontransient ischemic attacktribasic sodium phosphatecalycanthus occidentalisaristolochia serpentariasarvepalli radhakrishnanhenri emile benoit matissetyrosine kinase inhibitorrichard brinsley sheridansan carlos apache language
...View all with 23 letters...
Words (1)
schizosaccharomycetaceaePhrases (102)
argyroxiphium sandwicenseprimary sex characteristicbattle of the spanish armadabrassica oleracea acephalaarthur meier schlesinger jr.existentialist philosophyfranz seraph peter schuberthypersensitivity reactioncharles augustus lindberghcharles camille saint-saens
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (75)
mary wollstonecraft shelleybattle of the chemin-des-damescruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionpolystichum acrostichoidesmelanerpes erythrocephalussaddam bin hussein at-takriti
...View all with 25 letters...
Phrases (62)
helen maria fiske hunt jacksonchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidsir sarvepalli radhakrishnannational institutes of healthwar of the austrian successionjames abbott mcneill whistlerjohn burdon sanderson haldaneherpes varicella zoster virus
...View all with 26 letters...
Phrases (40)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerdeoxyadenosine monophosphatecryptobranchus alleganiensistaras grigoryevich shevchenkohomo sapiens neanderthalensisstationary stochastic process
...View all with 27 letters...
Phrases (45)
coccothraustes coccothraustesaleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristiccommission on the status of womenjohan julius christian sibeliusfederal housing administration
...View all with 28 letters...
Phrases (27)
aleksandr nikolayevich scriabindisorganized type schizophreniadmitri dmitrievich shostakovichcapital of the russian federationhydrangea macrophylla hortensisconstitution of the united statesstephanus johannes paulus krugerpresident william henry harrisonsecond epistle to the corinthiansgeorges joseph christian simenon
...View all with 29 letters...
Phrases (27)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndrome
...View all with 30 letters...
Phrases (16)
united states public health servicesecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrunsir john frederick william herschelanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouartcommonwealth of independent statesfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (14)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzki
...View all with 32 letters...
Phrases (13)
characteristic root of a square matrixepistle of paul the apostle to philemonorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (15)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human services
...View all with 34 letters...
Phrases (10)
national baseball hall of fame and museumjohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadehereditary motor and sensory neuropathychristopher william bradshaw isherwoodtransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelalbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyaPhrases (9)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothysecretary of housing and urban developmentkarl friedrich hieronymus von munchhausendefense advanced research projects agencyepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwigsupreme headquarters allied powers europe
