Words Containing: A,E,H,R,S,Y
(In Any Order)
There are 1,112 words,
1,435 phrases and
0 abbr's with
A,E,H,R,S,Y in.
Best Scoring Words With: A,E,H,R,S,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hyraxes | 7 | 20 | nounn | |||||
noun • any of several small ungulate mammals of Africa and Asia with rodent-like incisors and feet with hooflike toes | ||||||||
| hyraces | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hydrase | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hearsay | 7 | 13 | noun, adjectiven, adj | |||||
noun • gossip (usually a mixture of truth and untruth) passed around by word of mouth adjective satellite • heard through another rather than directly | ||||||||
| hayers | 6 | 12 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (33)
hairstylehorseplayseaworthyanywheresoverhastyhydrolasehysteriaserythemaspyorrheashymnariesyahrzeitspharyngespharynxeseurybathstrachyteshaymakersdyarchiesshadberryhereawaysbearishlyyravishedanhydrasesphyraenasharp-eyeddrayhorsexerochasyhyperstathedysarumhydremiashorsewaystheocrasygytrashespamphreysPhrases (7)
ready cashheavy sparhair stylestay freshdray horsehenry's laweasy chairWords (84)
hystericalhyperspacelachrymosesoothsayerfreakishlyharmlesslysaprophyteholidayersdehydratesgynarchiescoryphaeusrehydrateshairstylesshrievaltyaerophyteshydrangeasmythmakershorseplaysparaphysespachydermssuperheavyserigraphycrayfishesathrocyteshydrolasesanhydridesanhydritespyorrhoeashyperopiasmelaphyrescherimoyashypodermashyperpneasjayhawkershydrospace
...View all with 10 letters...
Phrases (20)
henry jameshouse partylawyer bushschool yearcrazy horsecrazy housemother's dayfather's daykhyber passsand cherry
...View all with 10 letters...
Words (120)
horseplayerbathyspheresympathizersphericallyphraseologysympathiserheartlesslybreathalysescenographyhyperplasiastenographyhoneyeatersdehydratorshydroplanessaprophytessearchinglyunseaworthyparenchymaschrysalisessoothsayersbellyachersheartsomelyaerenchymasphylloxerassquirearchyphalansteryflycatchersphysiatrieshypermaniasprophylaxeshypermediashydromedusahypermnesiamethylatorshydrophanes
...View all with 11 letters...
Phrases (18)
mary shelleysensory hairchess playerthorny skateprayer shawlvariety showflash memorybaby's breathcase historyeast by north
...View all with 11 letters...
Words (174)
hystericallybreathlesslypraiseworthychrestomathyerythematoushaberdasherysuperhighwaybreathalyserdysmenorrheatracheostomysuperhumanlystonyheartedfarsightedlyoropharyngeshyperkinesiaunhystericalhemihydratesseraphicallysympathizershyperplasiasseismographyhyperactivesbathyspherestypographerspolygrapherstypographieshydroxylasesamateurishlyhydrogenasesxylographieslachrymoselytetrahymenassepulchrallyhypothermiasstereography
...View all with 12 letters...
Phrases (31)
barbary sheepmass hysteriagenus sphyrnahylobates largenus coryphadame myra hessstay togetherbody snatchergenus enhydrachemistry lab
...View all with 12 letters...
Words (171)
chrysanthemumpsychotherapyphysiotherapydehydrogenasehydrocephalustreacherouslypyrophosphatesoutheasterlynortheasterlysaccharomycesoystercatcherbrachypterousperishabilityhyaluronidasespermatophyteholidaymakerssoftheartedlyphosphorylatehypothecatorsphysiographerhymenopteranshyperacuitiesyellowthroatsnonhystericalpyrocatecholssuperphysicalhypercautioushyperurbanismsuperhighwaysphosphorylasehydrographershydrographiesattorneyshipsstylographiesamphiprostyle
...View all with 13 letters...
Phrases (57)
harvey cushingel iskandriyahshammy leatherthree kings' daygenus pyrrhulahorse-and-buggyhouse of prayerdubose heywardhenry m. stanleyhenry steinway
...View all with 13 letters...
Words (160)
thermodynamicsnarcosynthesisphosphorylatedplethysmographhydrotherapistpraiseworthilypachydermatousstretchabilityphosphorylateshypermasculinedehydrogenaseshypermetropiasoystercatcherspyrimethamineshyperrealisticphytoplanktershyperawarenesscryptographersparenchymatouspseudepigraphyspermatophytesspermatophyticplethysmogramshyperesthesiasstoutheartedlylachrymositiesphosphorylasesamphiprostyleshyperkeratoseshyperkeratosisearthshakinglyhypnotherapiesschoolmasterlyhypnotherapistbutyraldehydes
...View all with 14 letters...
Phrases (69)
anthony burgessblackberry bushchinese parsleyjapanese cherrygenus chrysaorahenry cavendisherythema solareartillery shellgenus sphyraenasir henry morgan
...View all with 14 letters...
Words (133)
psychotherapistphysiotherapistheterosexualityneuropsychiatryimperishabilitypolysaccharidesdishearteninglyhyperaggressivehypersalivationpsychometriciancyproheptadineshyperstimulatedhyperstimulatessaccharomyceteshypervigilanceshyperfastidiousionosphericallyphosphorylativehyperinflationshypnotherapistshyperlipidemiashypermetabolismmethoxyfluranesatmosphericallyphenylthioureashypochondriasesphysiotherapiesglutaraldehydeshyperparasitismdermatoglyphicsglyceraldehydesarchaeopteryxeshyperactivitiessemipornographygeostrophically
...View all with 15 letters...
Phrases (96)
mrs. humphrey wardhyoscyamus nigerspiny-headed wormscholarly personarachis hypogaeamythical monsterchicory escaroledehydrated foodsthree-day measlesanchovy dressing
...View all with 15 letters...
Words (69)
sphygmomanometererythroblastosisthermostaticallyneuropsychiatrichypersalivationshypersexualitiesthermoplasticityhyperstimulatinghyperstimulationparapsychologiesparasympatheticsapocryphalnesseshypervitaminosessphygmomanometryglossopharyngealarchaeoastronomyarchiepiscopallystenographicallystereophonicallyperiphrasticallycaryophyllaceousphenylketonuriasneurasthenicallyheavyheartednessdehydrogenationsmechanochemistryneurohypophysealneurohypophysialphosphoglycerategynandromorphieshysterocatalepsyelectromyographssuperheavyweighthematoporphyrinsmacrothelypteris
...View all with 16 letters...
Phrases (102)
christian huygensgenus crotaphytusacross the countrynevil shute norwaypharyngeal tonsilrheims-douay biblereligious holidayhenry schoolcraftthysanuran insectsuper heavyweight
...View all with 16 letters...
Words (41)
psychotherapeutichyperreactivitiesphysiotherapeuticparaformaldehydeshyperstimulationshyperventilationssphygmomanometersthrombocytopeniascrystallographerscrystallographiesbathythermographsstereophotographypheochromocytomasdehydrochlorinaseglossopharyngealsorthopsychiatriestriphenylmethanesphosphoglyceratesneuropsychiatriesneuropsychiatristmesembryanthemumssuperheavyweightsdesynchronisationdesynchronizationdephosphorylatingdephosphorylationrhynchocephalianspseudoparenchymasschizophrenicallypsychobiographershydrometallurgieshydrometallurgistpsychobiographieseleutherodactylusantihypertensives
...View all with 17 letters...
Phrases (130)
interstate highwayclass rhodophyceaeprimary censorshippetasites hybriduspython reticulatusgenus chlamyphorusgenus dactylorhizajaroslav heyrovskyoncorhynchus nerkaegyptian paper rush
...View all with 17 letters...
Words (38)
characteristicallyhyperaldosteronismneuropsychologicalhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieslipopolysaccharidelymphangiographiesstoichiometricallypteridospermaphytamucopolysaccharidehypercholesteremiasaccharomycetaceaedehydrochlorinasesdehydrochlorinatesspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesheavyheartednessespachycephalosaurusdephosphorylationspseudoparenchymatachlortetracyclineshydrometallurgistscytoarchitectonicshydroxytryptamineshyperalimentationsdihydroergotaminesdimethylhydrazinesneurophysiologicalhyperimmunizationshypernationalistic
...View all with 18 letters...
Phrases (136)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyshort-term liabilityarchitectural stylecrataegus oxycanthaarthur garfield haysgossypium herbaceumpolish monetary unit
...View all with 18 letters...
Words (21)
hyperparathyroidismhypersensitizationsparathyroidectomiesmucopolysaccharideslipopolysaccharidesphosphoenolpyruvatethird-dimensionalityhysterosalpingogramthree-dimensionalitymethylcholanthrenesparasympathomimeticdiethylcarbamazineshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiesschizosaccharomycesPhrases (121)
hydrastis canadensisgiles lytton stracheygenus cryptobranchusgenus symphoricarposavogadro's hypothesischinese monetary unithydrobates pelagicusuniversity of chicagobritish monetary unitcrataegus oxyacantha
...View all with 19 letters...
Words (25)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhyperadrenocorticismlymphogranulomatosesbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicselectrophysiologicalencephalomyocarditispseudoparenchymatoushydrochlorothiazidespsychopharmacologieshypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (109)
yellow-shafted flickerbalaenoptera physalusdivision tracheophytamilton snavely hersheyfriendly relationshipsouth american countryluscinia megarhynchoshyperoodon ampullatusclarence shepard day jr.genus campylorhynchus
...View all with 20 letters...
Words (6)
acetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieshypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (103)
aleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomahenry hobson richardsonagricultural chemistryhans holbein the youngersyngnathus hildebrandiwhite-coat hypertensionbhutanese monetary unit
...View all with 21 letters...
Words (5)
spectrophotometricallyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (86)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberhenry engelhard steinway
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (68)
family threskiornithidaekazakhstani monetary unitbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy missionchrysanthemum parthenium
...View all with 23 letters...
Words (2)
laryngotracheobronchitisschizosaccharomycetaceaePhrases (55)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprimary sex characteristictechnology administrationhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanumoxidative phosphorylation
...View all with 24 letters...
Phrases (46)
embryonal rhabdomyosarcomamary wollstonecraft shelleypolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blair
...View all with 25 letters...
Phrases (37)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (31)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulussystema nervosum periphericum
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (22)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl celluloseaspidophoroides monopterygius
...View all with 28 letters...
Phrases (13)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (13)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (1)
respiratory distress syndrome of the newborn
