Words Containing: A,E,E,S,Y
(In Any Order)
There are 1,587 words,
2,767 phrases and
0 abbr's with
A,E,E,S,Y in.
Best Scoring Words With: A,E,E,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
veejays | 7 | 20 | verb, nounv, n | |||||
noun • Someone who presents a television programme of videos; a video jockey. • Vagina, vulva. | ||||||||
jayvees | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
deejays | 7 | 18 | nounn | |||||
noun • A disc jockey. verb • To perform as a disc jockey. | ||||||||
jaygees | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
eyewash | 7 | 16 | nounn | |||||
noun • lotion consisting of a solution used as a cleanser for the eyes | ||||||||
peaveys | 7 | 15 | nounn | |||||
noun • a stout lever with a sharp spike; used for handling logs | ||||||||
hayseed | 7 | 14 | noun, adjectiven, adj | |||||
noun • a person who is not very intelligent or interested in culture | ||||||||
mameyes | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
eyelash | 7 | 13 | nounn | |||||
noun • any of the short curved hairs that grow from the edges of the eyelids | ||||||||
leeways | 7 | 13 | ||||||
noun • (of a ship or plane) sideways drift • a permissible difference; allowing some freedom to move within limits | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (57)
speedwayweekdayseasterlyheavysetwesleyaneyeshadeovereasyedgewayssedatelyeyeglassexabytesaverselycayennesyearliesbelayersweasellycypselaegayetieshayseedsdelayersfreewaysandesyteestrayedyearendsyearnersyeasayeryeastierempyemasdecayerstypecaseamyleneseyeballswalleyeslayetteseyebeams
...View all with 8 letters...
Phrases (5)
seed trayglass eyegrey sagenew year'ssweet bayWords (126)
yesterdaynecessarysecretarywednesdayspeakeasyemphysemaearnestlykeynesianadverselyawesomelyanywheressedentaryeyestrainausterelypederastyeyeshadowseverallyhymenealsoxygenasefeedyardsspeedwayseasefullyabeyancesempyreansdefrayersbetrayerstypefacesyammererserythemasgreenwaysresprayednaseberryeyeshadesevasivelyyarmelkes
...View all with 9 letters...
Phrases (19)
speech daymealy sagesafety netpaul heysesea lawyersnake eyesevery lastgrey skatemercy seatsteel gray
...View all with 9 letters...
Words (167)
especiallyscreenplayseparatelyhyperspacesleepyheadexpresswaycyberspacecarelesslyeyeglassesfearlesslyoverstayedseamlesslyreassemblyyesteryeardesolatelyepiphysealclydesdaleascendencysynaeresisdetestablyratepayersassertedlyaversivelydehydratesreanalysesreanalyzesrepaymentsrehydratescybernatesskeletallyaerophytesnamelesslycanyoneersembaymentssemiyearly
...View all with 10 letters...
Phrases (38)
brya ebenusheavy swellcase-by-caseeaster lilyhenry jamessean o'caseytake it easyjames joycesafety islehelen hayes
...View all with 10 letters...
Words (203)
necessarilyessentiallydesperatelyunnecessaryshamelesslyhorseplayerbathyspheresedimentaryceaselesslysynesthesiaschenectadyfreemasonrypsychedeliarespectablywensleydaleheartlesslysteeragewaysuperagencypresentablybreathalysesystematisesystematizeascomycetesblamelesslygracelesslyassemblymenhoneyeatersemployablesdeathlesslypurveyancespolychaetescaressivelywearilesslydaydreamerswearisomely
...View all with 11 letters...
Phrases (87)
louis leakeymary shelleyfree-and-easybicycle seatlevy en massemackerel skycoyote statesweat equitycaraway seedeaster bunny
...View all with 11 letters...
Words (232)
aggressivelyclytemnestrapresbyterianbreathlesslyextrasensorysystematizederythematoushaberdasheryexhaustivelysequentiallybreathalyserrecessionarydysmenorrheatransverselysynaesthesiaestheticallypersuasivelysystematizerstonyheartedeleemosynaryextraneouslyregardlesslyantiepilepsygerrymandershyperkinesiarestrainedlymethylaminespresbyterialshamefacedlyhemihydratesentrancewaysdecasyllableesotericallydeoxygenatessystematised
...View all with 12 letters...
Phrases (114)
backspace keyearnest moneywaste of moneybarbary sheeptreasury notegenus apteryxbrewer's yeasttennis playergenus eucaryabuckeye state
...View all with 12 letters...
Words (220)
unnecessarilysupplementaryeverlastinglystereotypicalaestheticallydehydrogenasesentimentallyexistentiallytreacherouslymeaninglesslysuperlativelysoutheasterlyconsideratelyembarrassedlynortheasterlyclandestinelyoystercatcherbasidiomycetesqueezabilityspermatophytesoftheartedlyassemblywomenviceroyaltiesencyclopediascrestfallenlytetrapyrroleshymenopteransprayerfulnessunderstatedlyspeculativelyhyperacuitiesenjoyablenesstemerariouslysempiternallyeasygoingness
...View all with 13 letters...
Phrases (140)
auditory sensespiny anteaterwaste of energytaste propertycooley's anemiaacrylate resingenus cyclamenfeast one's eyesgenus gypaetusbattle of ypres
...View all with 13 letters...
Words (205)
sentimentalityrespectabilityundersecretaryconservativelyanesthesiologyserviceabilityabsentmindedlyhypermasculinedehydrogenasespolybutadieneshypermetropiasunrestrainedlysystematicnessunsystematizedoystercatcherspyrimethaminespresentabilityhyperrealistichyperawarenessexasperatinglypseudepigraphydaguerreotypesdiphenylaminesspermatophytesincandescentlycommensuratelyresystematizedresystematizeshyperesthesiasstoutheartedlyrecrystallizedrecrystallizessupersexualityencyclopaediashyperkeratoses
...View all with 14 letters...
Phrases (160)
battle of nasebymoonseed familyorder mysidaceaskeletal systemcooley's anaemialacrosse playerdrainage systemchinese parsleymost especiallyjapanese cherry
...View all with 14 letters...
Words (145)
anaesthesiologyheterosexualitypostoperativelydemonstrativelyinconsideratelyeuphemisticallysymmetricalnesskinestheticallysemidocumentaryemployabilitiespsychedelicallymethylxanthinesdishearteninglyelectroanalysishyperaggressiveconsequentiallycyproheptadineshyperstimulatedhyperstimulatessaccharomycetesdaguerreotypistenjoyablenesseshypervigilancesresystematizingelectromyogramsinterpersonallystereologicallyhyperlipidemiashypermetabolismmethoxyfluranesstereotaxicallylymphadenitisesphenylbutazonessympathectomiesmiscellaneously
...View all with 15 letters...
Phrases (209)
stay of executioncentaurea cyanusclass pelecypodaalimentary pasteadvisory serviceorycteropus aferwassily leontiefspiny-headed wormerlenmeyer flaskjoyce carol oates
...View all with 15 letters...
Words (74)
quintessentiallysphygmomanometerextemporaneouslyhypersexualitiesapocryphalnesseshypervitaminosescryopreservationlyginopteridalesstereophonicallyecclesiasticallygastroenterologycyclohexylaminesstereoregularitystereoscopicallykinaestheticallydaguerreotypistsunrespectabilityconsequentialityphenylketonuriasneurasthenicallyacetylsalicylateheavyheartednesssyncategorematicsemitransparencyadenohypophysealdehydrogenationsmechanochemistryneurohypophysealintercrystallinemegagametophytesphosphoglyceratemycoplasmataceaehysterocatalepsyrepresentativelytyrannicalnesses
...View all with 16 letters...
Phrases (210)
in a beastly manneramerican sycamorenevil shute norwaymechanical systemexemplary damagescalystegia sepiumlaundry stiffenergenus aptenodytesisland of guernseyorder polygonales
...View all with 16 letters...
Words (45)
electrostaticallycontemporaneouslyinconsequentiallypsychotherapeutichyperreactivitiesisoelectronicallyphysiotherapeuticparaformaldehydeshyperventilationssphygmomanometerscryopreservationsencephalomyelitisdisrespectabilitylymphadenopathiesgastroenterostomycytomegalovirusesphenylethylaminesstereophotographyacetylsalicylatesdehydrochlorinasesamoyedic-speakingtriphenylmethanesphosphoglyceratesneuropsychiatriesmesembryanthemumssuperheavyweightscarboxypeptidasesdeoxyribonucleasedepolymerizationsone-dimensionalitypseudoparenchymasdeterministicallyhydrometallurgiesepistemologicallysymmetricalnesses
...View all with 17 letters...
Phrases (254)
balaena mysticetusinterstate highwaypearly everlastingclass rhodophyceaetheological systemcylinder separatorcaesarian deliverypetasites hybridusinvestment companygettysburg address
...View all with 17 letters...
Words (35)
inconsequentialityhyperaldosteronismpolyesterificationhypersensitizationspectroheliographypsychotherapeuticssphygmomanometriespentylenetetrazolscylindrical-stemmedstereospecificallypteridospermaphytahypercholesteremiasaccharomycetaceaemagnetostrictivelydehydrochlorinasesdehydrochlorinatesgranulocytopoiesesaerothermodynamicsrepresentationallyelectromyographiesheavyheartednessesmethylnaphthalenesdeoxyribonucleaseshomobasidiomycetespseudoparenchymatachlortetracyclinessedimentologicallysemiconservativelyhyperalimentationssemiprofessionallysemiquantitativelydihydroergotaminesdimethylhydrazineshyperpigmentationshyperrationalitiesPhrases (242)
family physeteridaedame sybil thorndikelachrymal secretionclass schizomycetesfamily asparagaceaefamily desmidiaceaesquirreltail barleymegacycle per secondbattle of tewkesburygenus chamaecytisus
...View all with 18 letters...
Words (19)
polyesterificationshypersensitizationsparathyroidectomiescytopathogenicitiesphenomenalisticallyelectrodynamometersphosphoenolpyruvatethree-dimensionalitymethylcholanthrenesencephalomyelitidesdiethylcarbamazineshyperconcentrationstetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiesexpressionisticallyPhrases (230)
seventeen-year locustgiles lytton stracheyfamily lepisosteidaezairese monetary unitjacques yves cousteauchinese monetary unithydrobates pelagicuscost-benefit analysissubfamily mephitinaesubfamily perdicidae
...View all with 19 letters...
Words (16)
hypercholesterolemiaoverenthusiasticallyhyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateselectrophysiologicalencephalomyocarditispseudoparenchymatoussyncategorematicallyhypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesexistentialisticallyPhrases (209)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesbalaenoptera physalusbalance sheet analysisbyelorussian languageuniversity of nebraska
...View all with 20 letters...
Words (6)
stereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydehypercholesterolemiaspsychotherapeuticallyPhrases (150)
aleksandr solzhenitsynhelichrysum bracteatumdesoxyribonucleic acideucalyptus fraxinoidesstrawberry haemangiomaptolemy ii philadelphussoren aabye kierkegaardsamuel taylor coleridgehans holbein the youngerfamily grossulariaceae
...View all with 21 letters...
Words (5)
spectrophotometricallyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (130)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factloyalist volunteer forceathyrium thelypteroidesmale reproductive systemsurinamese monetary unitatmospheric electricityindonesian monetary unitcombined dna index system
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (103)
family threskiornithidaeyellowstone national parkparis-sorbonne universitybangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytatricyclic antidepressantmcguffey eclectic readers
...View all with 23 letters...
Words (2)
phosphatidylethanolamineschizosaccharomycetaceaePhrases (88)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisalexandre emile jean yersinexistentialist philosophy
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (73)
myroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldmelanerpes erythrocephalusbeggar-my-neighbour strategytrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovskywestern samoan monetary unit
...View all with 25 letters...
Phrases (59)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandnewton's theory of gravitationsubdivision deuteromycotina
...View all with 26 letters...
Phrases (47)
business environment analysisnikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugincommissioned military officernuclear regulatory commissiondeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drugdeoxythymidine monophosphate
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (37)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist league
...View all with 28 letters...
Phrases (25)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencebalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndromecalifornia personality inventory
...View all with 30 letters...
Phrases (11)
freedom from involuntary servitude2019-ncov acute respiratory diseaserevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activitydefense information systems agencyfrequency-response characteristic
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleytheory of electrolytic dissociation
...View all with 32 letters...
Phrases (12)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitis
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (9)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyfield-sequential color television systemsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agency
...View all with 37 letters...