Words Containing: A,E,E,H
(In Any Order)
There are 8,445 words,
7,132 phrases and
0 abbr's with
A,E,E,H in.
Best Scoring Words With: A,E,E,H
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
exhaled | 7 | 18 | verbv | |||||
verb • expel air • give out (breath or an odor) | ||||||||
hadjees | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
hexades | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
exhedra | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hadjee | 6 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hexade | 6 | 17 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
exhales | 7 | 17 | verbv | |||||
verb • expel air • give out (breath or an odor) | ||||||||
hexanes | 7 | 17 | nounn | |||||
noun • a colorless flammable liquid alkane derived from petroleum and used as a solvent | ||||||||
behaved | 7 | 16 | adjectiveadj | |||||
verb • behave in a certain manner; show a certain behavior; conduct or comport oneself • behave in a certain manner • behave well or properly | ||||||||
exhale | 6 | 16 | verbv | |||||
verb • expel air • give out (breath or an odor) | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (205)
teacherbreatheweathertheaterachievetheatrebeneathheavensheatherleatherfeatherwhereasheartedbehavedathletetheresaheaviercheatercheetahredheadenhancemethanemacheteheathenheadseteyelasheggheadrebekahshearedbansheemachreesheavescheapenreshapeadhered
...View all with 7 letters...
Phrases (13)
heave uple havreaxe headherb teasea haresage hennan heelhead seared heatpay heed
...View all with 7 letters...
Words (512)
whateveranywhereresearchexchangeelephantheadachegatheredthreatenforeheadachievedhesitateheavenlyfeathersrehearsepreacherheritagehomemadeheadlineoverheadhammeredenhancedheadlessdetachedbreathedbeheadedbreatherhardenedrechargedeathbedjeremiahboneheadephesianseashoreheaviestcashmere
...View all with 8 letters...
Phrases (44)
sea horseheated uphead licecar wheelbeer hallshoe lacewater hensea chesttea chesthead ache
...View all with 8 letters...
Words (879)
challengeelizabethexhaustedcatherinerehearsalmeanwhilewarehousehalloweenheartbeatshatteredshamelessheartlesssheldrakeoverheardexchangedenchantedphenomenahereafterchevaliertelegraphrehearsedcheckmatehealthieremphasizeaesthetichesitatedhelveticawholesaleheartfelttreacheryheartachechameleonmisbehavesharpenedchartered
...View all with 9 letters...
Phrases (117)
cone shapehead lousewhole galehoe handlemale horsebret hartewhite heatalex haleyhome platehome range
...View all with 9 letters...
Words (1140)
sweetheartatmospherethreatenedunderneathearthquakewhatsoeverwheelchairaltogetherleadershipmanchesterheadmasterrehearsingchallengedcopenhagenstepfatherbeforehandphenomenalresearcherheadphoneschallengerbreathlesschandelieranesthesiahereditaryanestheticheartbreakfahrenheithyperspacedehydratedweathermanhemorrhagecheesecakechimpanzeedetachmentcheapskate
...View all with 10 letters...
Phrases (209)
d. h. lawrencehoney eatergoat herderelizabeth irefuse heapfor each onewheat berrywagon wheeltree branchheavy swell
...View all with 10 letters...
Words (1311)
threateningestablishedshakespearewhereaboutsinheritanceachievementcheerleaderhairdressermerchandiseheartbrokentreacherousheavyweighttheoreticalnetherlandsapprehendedneanderthaltherapeuticheadquarterknuckleheadwheelbarrowshareholderhypermarketshamelesslyanaestheticenchantmentthunderheadunreachablehyperactiveanaesthesiaenhancementpaperhangerbeachcomberoverheatingamphetaminehaemorrhage
...View all with 11 letters...
Phrases (321)
's gravenhageweather sideweather vanesheet anchormary shelleyhoney badgercrowned headswelled headhead of statefire watcher
...View all with 11 letters...
Words (1260)
headquartersarchitecturehandkerchiefcheerleadingmichelangelochemotherapyheterosexualheadmistresssledgehammerbacheloretteorchestratedformaldehydestepdaughterapprehensionapprehensiveheartbreakerrehabilitateflamethrowerstratospherenortheasternspeakerphonecharacterizeschopenhauerauthenticatehasenpfefferdisheartenedperipherallyunchallengedamphitheatersoutheasternsuperchargedcinemathequespeechmakingstenographerencephalitis
...View all with 12 letters...
Phrases (396)
graham greenehard-to-pleaseathene noctuagenus anethumhelen traubelgeorge m. cohanspace shuttlespace vehiclehead coveringcharnel house
...View all with 12 letters...
Words (1011)
establishmenttheoreticallyschoolteacherchoreographerheartbreakingschadenfreudecharacterizedrehabilitatedmagnetosphereauthenticatedhermaphroditeinexhaustibleshakespeareanpetrochemicalhorsefeathersshamelessnessthermonucleartenderheartedaestheticallybrokenheartedfeatherweightoceanographerunderachieverdehydrogenasehousecleaninganaesthetizedcharacterlessleatherjacketunimpeachablemetamorphosescharacterisedarchaeopteryxchloromethanehypercalcemiakaffeeklatsch
...View all with 13 letters...
Phrases (485)
telegraph postjohn masefieldwhite asbestosdelphic oraclemight-have-beenchelone glabraarcheozoic eonczech languagebreathing timelouis the great
...View all with 13 letters...
Words (817)
slaughterhousewholeheartedlyapprenticeshipnebuchadnezzarcholinesteraseelectrotherapyhyperventilateindecipherablewhippersnapperbreathlessnesstelepathicallybullheadednessunderachievingnonthreateningirreproachableencephalopathydisenchantmentextravehicularchickenheartedfeatherbrainedheadmastershipdisenfranchisemechanicalnesshospitablenessdisinheritancefarsightednesstelephonicallyoveremphasizedanesthesiologyservomechanismchangelessnessshamefacednessundecipherableempatheticallycyproheptadine
...View all with 14 letters...
Phrases (561)
weather outlookpaleolithic agebreathing placenoachian delugebreathing spacebreathing spellauf wiedersehencastle in the airto a higher placechanson de geste
...View all with 14 letters...
Words (584)
cinematographermethamphetaminedisenfranchisedanaesthesiologyinterchangeableheterosexualitymisapprehensionparthenogenesisparentheticallytherapeuticallyenfranchisementmethylphenidateencephalographylightheadednesscatheterizationnearsightednessheartbreakinglyeuphemisticallyatherosclerosisunderhandednessunchallengeablephenolphthaleindiphenhydraminesubstratosphereelectrochemicalkindheartednesskinestheticallycholecalciferolsoftheartednessdownheartednessblameworthinesswarmheartednessthermoregulatorcoldheartednessphosphocreatine
...View all with 15 letters...
Phrases (637)
charlotte brontebitter chocolatehigh renaissancetarzan of the apesbottlenose whalebelgian shepherdacheta domesticameat thermometerhigh temperatureathletic contest
...View all with 15 letters...
Words (265)
anesthesiologisttriphenylmethanehyperventilationchemotherapeuticphylogeneticallyelectromyographysphygmomanometerepiphenomenalismoverenthusiasticlightheartednessgastroesophagealunderachievementthermolabilitiesheterokontophytahymenophyllaceaeradiochemistriesspectroheliogramparaformaldehydethermometricallymicrogametophytehypersexualitiespraiseworthinessantitechnologiesthermoregulatingheterometabolismthermoregulationheterometabolousinheritabilitiesthermoregulatorsthermoregulatoryradiotelephoniesthermoremanencesapocryphalnesseshyperventilatinglargeheartedness
...View all with 16 letters...
Phrases (615)
manihot esculentaw. somerset maughamchelonian reptilehead cabbage plantstephane mallarmewilliam wycherleynathaniel curriergenus chaenomeleselizabeth haldaneatrium of the heart
...View all with 16 letters...
Words (146)
psychotherapeuticelectromechanicaldextroamphetamineinterrelationshiphyperreactivitiesphysiotherapeuticcercidiphyllaceaespectroheliogramsunexchangeabilityparaformaldehydesspectroheliographleukoencephalitiskindheartednessesdisestablishmentsthermoregulationsdisfranchisementsradiotelegraphiesinheritablenessesthermostabilitieshyperventilationssphygmomanometerscrashworthinesseschlortetracyclinefashionablenessesarchconservativespentachlorophenolmorphogeneticallytenderheartednesslevelheadednessesrechromatographedstandoffishnessesencephalomyelitismachine-accessiblemachine-controlledlymphadenopathies
...View all with 17 letters...
Phrases (660)
jacqueline cochranweather forecastercompetence hearinggenus globicephalacivil rights leaderclomiphene citrateczech monetary unitlebanese hizballahmary mcleod bethunepast-tense morpheme
...View all with 17 letters...
Words (94)
hyperaldosteronismdisenfranchisementinterchangeabilityhypersensitizationspectroheliographsspectroheliographythermoplasticitiesinharmoniousnessesinhospitablenessesdishonorablenessesfaintheartednesseslargeheartednessespsychotherapeuticsapprehensivenessessphygmomanometriesarchaeoastronomiespentachlorophenolsrechromatographieslightheartednessesmuddleheadednessesstereophotographicpraiseworthinesseshyperbilirubinemiaaustralopithecinesstoutheartednessespteridospermaphytatrichlormethiazidediethylmalonylureaimmunohematologieshypercholesteremiasaccharomycetaceaeechocardiographersphenomenologicallyechocardiographiesplasmodiophoraceae
...View all with 18 letters...
Phrases (550)
photographer's modelfamily physeteridaedame sybil thorndikebackspace characterlachrymal secretionedgar rice burroughsjohn orley allen tategeorge michael cohanmount rushmore statenathaniel hawthorne
...View all with 18 letters...
Words (61)
pseudohermaphroditepneumoencephalogramdisenfranchisementshypersensitizationsparathyroidectomieshypolipoproteinemiaparthenogeneticallyencephalomeningitisstereophotographiesresorcinolphthaleinauthoritativenessescytopathogenicitiesphenomenalisticallyphenylthiocarbamideelectrocardiographsechoencephalographyphosphoenolpyruvateneuropharmacologieselectromechanicallyphosphomonoesterasemeningoencephaliticthree-dimensionalitymeningoencephalitiselectrophoreticallyelectrophoretogramsmethylcholanthreneselectrophotographichemidemisemiquaversmakataimeshekiakiakreticuloendothelialelectroretinographselectroretinographyphotointerpretationencephalomyelitidesanticholinesterases
...View all with 19 letters...
Phrases (471)
rejoicing over the lawtheodore harold whiteread between the linesgiles lytton stracheyshakespearean sonnethandle with kid glovesbattle of saint-mihielcaesalpinia echinatahelianthus tuberosustube-shaped structure
...View all with 19 letters...
Words (36)
hypercholesterolemiaoverenthusiasticallyelectroencephalogramparadichlorobenzenesspectroheliographiesspectrophotometricalparathyroidectomizedhyperadrenocorticismphenylpropanolaminesphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicphosphoenolpyruvatesphosphomonoesteraseshyperlipoproteinemiaelectrooculographieselectrophotographieselectrophysiologicalanthropocentricitieselectroretinographicphotointerpretationsroentgenographicallyencephalomyocarditischemotherapeuticallypseudocholinesteraseantiestablishmentismchlorofluoromethanespseudoparenchymatousphotoreconnaissanceshypercoagulabilitiesnephroangiosclerosisdimethylnitrosaminesheterobasidiomycetesirreproachablenesses
...View all with 20 letters...
Phrases (420)
archeological remainsblack-capped chickadeegilbert charles stuartyellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaebusiness relationshipwalther hermann nernst
...View all with 20 letters...
Words (19)
electroencephalographdisestablishmentarianstraightforwardnessesestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismelectroencephalogramsphosphoglyceraldehydemeningoencephalitideselectromyographicallyelectroretinographiespolyvinyl-formaldehydepseudocholinesterasesarenaria-melanocephalahypercholesterolemiasindistinguishablenesspsychotherapeuticallyPhrases (358)
acrocentric chromosomesir john everett millaisabelmoschus esculentusadministrative hearinghead and shoulders abovefrances hodgson burnettcercopithecus aethiopshelianthemum scopariumaleksandr solzhenitsynanthriscus cereifolium
...View all with 21 letters...
Words (12)
pentamethylenetetrazoldisestablishmentariansspectrophotometricallyelectroencephalographselectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalanineestablishmentarianismsPhrases (295)
gregorian calendar monthhaliaeetus leucorhyphusschlumbergera truncatusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanaaleksandr i. solzhenitsynherbert marshall mcluhan
...View all with 22 letters...
Words (8)
electroencephalographicelectroencephalographercarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiaPhrases (178)
family threskiornithidaeparenthetical expressiontransient ischemic attackchlorpheniramine maleatearchibald percival wavellelectromechanical devicepharmacological medicinearistolochia serpentariahenri emile benoit matissebangladeshi monetary unit
...View all with 23 letters...
Words (8)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographerselectroencephalographiesmicroelectrophoreticallydichlorodifluoromethanesschizosaccharomycetaceaePhrases (180)
basque homeland and freedompelham grenville wodehouseargyroxiphium sandwicensedivision heterokontophytaprivately held corporationtrip the light fantastic toeprimary sex characteristicbattle of the little bighornbattle of the philippine seabattle of the spanish armada
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (128)
mary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medaltherapeutic rehabilitationboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionproprietorship certificate
...View all with 25 letters...
Phrases (103)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housefrances eliza hodgson burnettx-linked dominant inheritancebacon-lettuce-tomato sandwichnational institutes of healthright atrioventricular valvebattle of the teutoburg forestalternanthera philoxeroides
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (65)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinelectromechanical transduceraugustus welby northmore pugindirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunfloweradrenocorticotrophic hormonedeoxyadenosine monophosphate
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (68)
coccothraustes coccothraustesaleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngercommission on the status of womendemocratic republic of the congofederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevsky
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (42)
aleksandr nikolayevich scriabinchemical decomposition reactionfriedrich wilhelm august froebeldisorganized type schizophreniacapital of the dominican republicsouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitferdinand joseph la menthe mortonhydrangea macrophylla hortensis
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (35)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovaalexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaugust friedrich leopold weismann
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (26)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrunsir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (17)
nikolai andreyevich rimski-korsakovafrican american vernacular englishdepartment of the federal governmenthierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociation
...View all with 32 letters...
Phrases (20)
characteristic root of a square matrixbreach of trust with fraudulent intentepistle of paul the apostle to philemonbureau of alcohol tobacco and firearmsorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junction
...View all with 33 letters...
Phrases (18)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzhermann ludwig ferdinand von helmholtzdryopithecus rudapithecus hungaricusmassachusetts institute of technology
...View all with 34 letters...
Phrases (13)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadeimmaculate conception of the virgin maryhereditary motor and sensory neuropathychristopher william bradshaw isherwoodfederal democratic republic of ethiopiatransurethral resection of the prostate
...View all with 35 letters...
Phrases (12)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriya
...View all with 36 letters...
Phrases (13)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothytheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentdepartment of health education and welfarekarl friedrich hieronymus von munchhausendefense advanced research projects agencyepistle of paul the apostle to the ephesians
...View all with 37 letters...
Phrases (7)
second epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilleeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityepistle of paul the apostle to the colossiansPhrases (7)
islamic jihad for the liberation of palestinerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtzepistle of paul the apostle to the philippiansPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing