Words Containing: A,E,E
(In Any Order)
There are 37,786 words,
21,870 phrases and
0 abbr's with
A,E,E in.
Best Scoring Words With: A,E,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| cerveza | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| waxweed | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| eczemas | 7 | 20 | nounn | |||||
noun • generic term for inflammatory conditions of the skin; particularly with vesiculation in the acute stages | ||||||||
| begazed | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| veejays | 7 | 20 | verb, nounv, n | |||||
noun • Someone who presents a television programme of videos; a video jockey. • Vagina, vulva. | ||||||||
| jayvees | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| emblaze | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| eczema | 6 | 19 | nounn | |||||
noun • generic term for inflammatory conditions of the skin; particularly with vesiculation in the acute stages | ||||||||
| beeswax | 7 | 19 | nounn | |||||
noun • a yellow to brown wax secreted by honeybees to build honeycombs verb • cover with beeswax | ||||||||
| veejay | 6 | 19 | verb, nounv, n | |||||
noun • Someone who presents a television programme of videos; a video jockey. • Vagina, vulva. verb • To work as a video jockey; to present videos. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (640)
pleasebecameheavenescapeasleepleavesagreedcreateleadercareerfemaleeasierrepeatheadedbehavebeatenestateleaguedefeatearneddealerrevealsealedhelenaavenueseatedbewaredebateeasterteresaengagedecaderelatehealedavenge
...View all with 6 letters...
Phrases (14)
ice teatea setsea mewsea peasea pende sadeease upa levelred seae layer
...View all with 6 letters...
Words (1665)
becauseteachermessagegeneralrealizeearlierlearnedbreatheseveralexampleawesomecreatedpreparereleaseweatherpleaseddiseasetreatedtheaterescapedrelatedfederalengagedaveragegreaterreplaceachieverealiseeternaltheatrebeneathdreamedheavensleadersmeasure
...View all with 7 letters...
Phrases (85)
bee balmseed lacheave uple havrebeef teabeer canred meatdead setaxe headnew wave
...View all with 7 letters...
Words (3429)
whateveranywherepleasurejapanesegreatestpreparedresearchsergeantrealizedaudienceeverydaytreasureseparatereleasedexchangeacceptedcreaturenegativebasementelevatorentrancepatiencetalentedpeacefulfarewellelephantheadacheincreasecreativeeuropeanrelativenecklacegatheredmeantimeweakness
...View all with 8 letters...
Phrases (262)
leave outfree fallpaul kleesea horseheated upfire salesea lousehead liceseed coatgem state
...View all with 8 letters...
Words (5105)
yesterdaynecessarygentlemancelebratecigarettetreatmentsecretarychallengeagreementnewspaperdesperatestatementguaranteeelizabethmiserableunderwearwednesdayexhaustedsatelliteadventureseparatedcatherinecolleaguesomeplacealexanderrehearsaldefendantmeanwhilejerusalempermanentimmediatecooperatewarehousededicatedcancelled
...View all with 9 letters...
Phrases (601)
small beercone shapelobed leafface valuegreat sealpast tensepipe dreamrelated tocereal boxhead louse
...View all with 9 letters...
Words (5743)
especiallyappreciatesweetheartdepartmentlieutenanteventuallygenerationatmospherethreatenedunderneathreasonableappearancemanagementengagementresistanceaggressiveliteratureremarkableelectricalvulnerableearthquakewhatsoevervegetarianunderwaterguaranteedunbearablewheelchairaltogetherinevitableregardlessleadershiplegitimatescreenplayelementaryacceptable
...View all with 10 letters...
Phrases (992)
tea essencepole weaponmary leakeycover plateskagen oddedwarf elderair cleanerline backeredgar degasspace probe
...View all with 10 letters...
Words (5700)
immediatelyperformanceconcentrateembarrassedtemperaturethreateningtransferrednecessarilyinvestigatecelebratingcertificatecelebrationalternativeestablishedshakespearesupermarketarrangementmaintenancereservationmeaninglesssentimentalreplacementessentiallywhereaboutsdemonstratedesperatelyunnecessaryrespectablemasterpieceappreciatedbattlefieldacknowledgeinheritanceexceptionalachievement
...View all with 11 letters...
Phrases (1341)
name dropperpole vaultergreat revoltbitter aloesgenus crambe's gravenhageleave officelouis leakeyskagens oddespace needle
...View all with 11 letters...
Words (4872)
unbelievableheadquarterssurveillanceannouncementpresentationintellectualrefrigeratorkindergartenpresidentialentertainingarchitecturedeliberatelyunacceptablemademoiselleconservativehandkerchiefinvestigatedexaggeratingexperimentalconcentratedunreasonableconsiderablecheerleadingmichelangelochemotherapyunbelievablydemonstratedaffectionateillegitimateinterrogatedheterosexualfrankensteinveterinarianpenitentiarytroublemaker
...View all with 12 letters...
Phrases (1627)
graham greenespace capsulehard-to-pleasetrouble makerathene noctuaalec guinnessel libertadorsecond adventgenus anethumhelen traubel
...View all with 12 letters...
Words (3697)
entertainmentestablishmentunderestimateenvironmentaldisappearanceembarrassmentdeterminationunpredictablemediterraneanunnecessarilyunforgettabletheoreticallyencouragementadvertisementschoolteacherexceptionallychoreographerinvestigativeeavesdroppingexterminationknowledgeableindispensableinconsiderateirreplaceableinconceivableheartbreakingdifferentiatedeterioratingquestionnaireindescribableschadenfreudedeteriorationinadvertentlycharacterizedrehabilitated
...View all with 13 letters...
Phrases (1861)
telegraph postjohn masefieldbakke decisiongenus blaberusremovable diskwhite asbestosdelphic oracletrade stoppagemight-have-beenauditory sense
...View all with 13 letters...
Words (2851)
representativerecommendationinterpretationunderstandablerepresentationreconnaissanceslaughterhouseunderstatementintellectuallywholeheartedlyimplementationaffectionatelyelectronicallyapprenticeshipimpressionableantidepressantexcommunicatedunrecognizablecontemporariessentimentalitynewspaperwomanaggressivenessrespectabilityextraordinaireunpremeditatedmeteorologicalinterplanetaryaforementionedecclesiasticalunpleasantnessundersecretaryquintessentialtranscendentalelectroplatingmountaineering
...View all with 14 letters...
Phrases (2009)
leave of absencefamily apiaceaegalileo galileiimperative formbasque languagenegeri sembilanpassover suppergenus pelecanusimperative moodpearl mae bailey
...View all with 14 letters...
Words (2029)
electromagneticrevolutionariescinematographerexperimentationmethamphetamineacknowledgementenvironmentallyentrepreneurialdisenfranchisedinconsequentialanaesthesiologyinterchangeableoverzealousnessunpronounceableintercollegiatespermatogenesisdifferentiationheterosexualitymisapprehensionparthenogenesisdesensitizationdevelopmentallydifferentiatingmeaninglessnessintellectualismintellectualityparentheticallyplenipotentiaryappropriatenessgastroenteritisneoconservativemaneuverabilitytherapeuticallyintellectualizeenfranchisement
...View all with 15 letters...
Phrases (2038)
measuring devicestay of executionteutoburger waldavestan languagecentaurea cyanuscharlotte brontedame muriel sparkfalco peregrinusbitter chocolateoutside marriage
...View all with 15 letters...
Words (833)
extraterrestrialintercontinentalenvironmentalistanesthesiologistelectromagnetismneurotransmitterundersecretariesenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationquintessentiallychemotherapeuticphylogeneticallyreinterpretationunreasonablenesselectromagneticselectromyographyintellectualizedsphygmomanometerdemineralizationovercompensationostentatiousnessinterpretationalextemporaneouslyinterventricularepiphenomenalismabsentmindednessarteriosclerosisoverenthusiasticpredeterminationcompartmentalizelightheartedness
...View all with 16 letters...
Phrases (1930)
tympanic membranemultiengine planecommedia dell'arteczar alexander iiimanihot esculentadame kiri te kanawain a beastly mannercartridge ejectorprofessional lifegenus crassostrea
...View all with 16 letters...
Words (488)
depersonalizationtelecommunicationmisinterpretationintergovernmentaltranscendentalismmisrepresentationelectrocardiogramcompartmentalizedintellectualizingelectrostaticallycontemporaneouslyinconsequentiallytranscendentalistcompartmentalisedinappropriatenesspsychotherapeuticelectromechanicaldextroamphetamineuncomfortablenessinterrelationshipdematerializationinterdepartmentalknowledgeablenesshyperreactivitiescountersignaturesinextricabilitiesirrevocablenessescounterstatementsisoelectronicallyparadoxicalnessesphysiotherapeuticcercidiphyllaceaespectroheliogramsunexchangeabilitycomfortablenesses
...View all with 17 letters...
Phrases (1830)
jacqueline cochranweather forecasterdame margot fonteynmary leontyne pricecompetence hearingdirect correlationpontederia cordatagenus globicephalalandscape gardenergenus ceratosaurus
...View all with 17 letters...
Words (272)
telecommunicationsinconsequentialitygastroenterologisthyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilityinexpugnablenessespolyesterificationexterritorialitieshypersensitizationcommensurabilitiesspectroheliographselectrodynamometercounterstrategistsmisinterpretationsspectroheliographythermoplasticitiesinharmoniousnessesknowledgeabilitiesmisrepresentationsradiosensitivitiesunpredictabilitiesinhospitablenessesdishonorablenessesfaintheartednesseslandlubberlinessescommunicablenessesrambunctiousnesseslargeheartednessesunprofitablenessesarteriolosclerosisappreciativenessesunreasonablenessespsychotherapeutics
...View all with 18 letters...
Phrases (1553)
arteria vertebralisoceanites oceanicusdouble-deck carriageprofessional golfererinaceus europaeusamerican revolutionisabella i of castilephotographer's modelfamily physeteridaeanamnestic reaction
...View all with 18 letters...
Words (178)
countertransferencesternocleidomastoidpseudohermaphroditeintellectualizationpneumoencephalogrampolyesterificationsdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesknowledgeablenessesextraterritorialityparathyroidectomiessurface-assimilativecommunicativenesseshypolipoproteinemiaparthenogeneticallycompanionablenessesdispassionatenessescompassionatenessesinstantaneousnessesencephalomeningitiscomplementarinessesreconceptualizationdisrespectabilitiesstereophotographiesresorcinolphthaleincounterdemonstratorcytodifferentiationauthoritativenessescytopathogenicitiesperspicaciousnessesobjectionablenessesphenomenalisticallyconsequentialnesses
...View all with 19 letters...
Phrases (1258)
measuring instrumentfavourable receptionerinaceus europeaeusaquilegia canadensisfamily cyclopteridaesierra madre orientalrejoicing over the lawseventeen-year locusttheodore harold whitecollective agreement
...View all with 19 letters...
Words (72)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyelectroencephalogramparadichlorobenzenesspectroheliographieskeratoconjunctivitescountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenessunsatisfactorinessesreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsintellectualizationsphenylpropanolaminesphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicadrenocorticosteroidphosphoenolpyruvatesrepresentationalismsrepresentationalistsphosphomonoesteraseshyperlipoproteinemiarepresentativenesseselectrooculographiesdestructive-metabolicelectrophotographiesinappreciativenesses
...View all with 20 letters...
Phrases (1018)
william stanley jevonssweet-scented geraniumarcheological remainsallium cepa aggregatumpelecanus onocrotalusblack-capped chickadeegilbert charles stuartyellow-shafted flickerappendicular skeletonwyethia amplexicaulis
...View all with 20 letters...
Words (36)
electroencephalographdisestablishmentarianextraterritorialitiesstereomicroscopicallymultidimensionalitiesconstructive-metabolicstraightforwardnessesestablishmentarianismalkylbenzenesulfonateinterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalelectroencephalogramscontemporaneousnessesadrenocorticosteroidsphosphoglyceraldehydemeningoencephalitideselectromyographicallyovercommercializationelectroretinographiespolyvinyl-formaldehydepseudocholinesterasesarenaria-melanocephalacountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenesseshypercholesterolemiasindistinguishablenesspsychotherapeuticallycounterinterpretationunexceptionablenesses
...View all with 21 letters...
Phrases (799)
use of goods and servicesacrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentalabelmoschus esculentusadministrative hearingelimination tournamenthead and shoulders abovesierra nevada mountains
...View all with 21 letters...
Words (20)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismelectroencephalographselectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineencephalomyocarditisescountercountermeasuresdihydroxyphenylalanineestablishmentarianismscounterinterpretationsPhrases (619)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphustransient global amnesiaschlumbergera truncatuscoronavirus disease 2019posterior nasal apertureredevelopment authorityhydrated aluminium oxide
...View all with 22 letters...
Words (11)
electroencephalographicnonrepresentationalismselectroencephalographercarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiaPhrases (395)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacksecond battle of el alameingeorge macaulay trevelyanchlorpheniramine maleateto all intents and purposesarchibald percival wavellsubpoena ad testificandum
...View all with 23 letters...
Words (10)
microgramma-piloselloideshyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (363)
basque homeland and freedomcarnegie mellon universitylouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaprivately held corporationtrip the light fantastic toe
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (280)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4myroxylon balsamum pereiraebalaenoptera acutorostratabureau of justice assistancebureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedradiamond wedding anniversary
...View all with 25 letters...
Phrases (200)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housefrances eliza hodgson burnettx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichnational institutes of healthright atrioventricular valvebattle of the teutoburg forest
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (134)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transduceroffice of management and budget
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (125)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemcommission on the status of women
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (102)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers association
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (67)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligence
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (66)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrun2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movement
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (44)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciation
...View all with 32 letters...
Phrases (40)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemonlycopersicon esculentum cerasiformeobject-oriented programming language
...View all with 33 letters...
Phrases (38)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicus
...View all with 34 letters...
Phrases (32)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation party
...View all with 35 letters...
Phrases (23)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyfield-sequential color television systemfreedom from cruel and unusual punishment
...View all with 36 letters...
Phrases (24)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeria
...View all with 37 letters...
Phrases (12)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activity
...View all with 38 letters...
Phrases (14)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (12)
nicotinamide adenine dinucleotide phosphateminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandino
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (8)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
