Words Containing: A,E,D,A,L,Y
(In Any Order)
There are 491 words,
1,886 phrases and
0 abbr's with
A,E,D,A,L,Y in.
Best Scoring Words With: A,E,D,A,L,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| alcayde | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| already | 7 | 11 | adverbadv | |||||
adverb • prior to a specified or implied time | ||||||||
| allayed | 7 | 11 | verbv | |||||
verb • lessen the intensity of or calm • satisfy (thirst) | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
alayedWords (38)
paralyzedparalysedsalesladycatalyzeddecayableunallayeddialysatedialyzatedebatablyamygdalesdelayableplayactedkaleyardsabashedlyplaydatesadrenallytwaybladeradiatelydefrayalsamygdalaejaywalkedwelladaysashamedlyalkylatedalarmedlylatter-dayseawardlydecanallycatalysedlygaeidaedryadelladaytalerseuryalidalaybackedsaleyards
...View all with 9 letters...
Phrases (5)
early daysmedal playgray aldernaked ladylay readerWords (42)
adequatelycardplayerunabatedlytalleyrandacrylamidereanalyzeddialysatesadjacentlydialyzatesdetachablyanimatedlyadaptivelyagitatedlydiaphysealtwaybladesdialyzabledefrayableacetylatedunanalyzedchlamydiaemarylanderreanalyseddrainlayerdialysableharassedlyunanalysedaplysiidaeheavy-ladeneastwardlyamygdalineeradicablyamygdalatedasypaedalaldermanrydapple-gray
...View all with 10 letters...
Phrases (13)
lead astraydaily breadalpha decayday laborerdart playeredna millaylady chapellady's lacescandy applepiddle away
...View all with 10 letters...
Words (47)
steadfastlyunabashedlyunashamedlyanecdotallyparaldehydedeclaratoryreadabilitybarefacedlycyclopaedialallygaggeddisplayabledialectallyacrylamidescardplayersedaphicallydisparatelyundebatablyballyraggedfatheadedlydeclamatoryascendantlyadverbiallyhydralazinedecanicallyloadsamoneydrainlayersdiametrallyaleyrodidaelogodaedalynymphalidaeadenomegalyaldermanitypachydermalsalicylatedarytenoidal
...View all with 11 letters...
Phrases (19)
dwindle awaymemorial dayalkyl halidedisplay casemeadow clarycalendar daybastille dayleading ladya. conan doyleclarence day
...View all with 11 letters...
Words (71)
accidentallyacademicallyinadequatelycardiomegalycalculatedlyoveranalyzedpedanticallyabstractedlyvaletudinaryhebdomadallyholidaymakershamefacedlydecasyllablerehydratableideationallydrapeabilitydisagreeablycadaverouslyhardheadedlyineradicablyadjectivallycyclopaediasdeflationarydaydreamlikeoctahedrallydecasyllabicheraldicallycarboxylatedhydralazinesdemoniacallysyllabicatedwallydraiglebackhandedlysacerdotallyacetaldehyde
...View all with 12 letters...
Phrases (42)
mary magdalenadmiral deweymaterial bodydevil-may-carefamily boidaegrand larcenyfamily zeidaedisplay paneladenylic acidresidual clay
...View all with 12 letters...
Words (85)
fundamentallyencyclopaediaadrenalectomyeducationallydiametricallyquadrenniallyembarrassedlyradioactivelyhalfheartedlyindefatigablypedagogicallyhyaluronidasespreadabilityholidaymakersaerodynamicaldetachabilityadumbrativelyaperiodicallyclearheadedlyexpandabilitytetrahedrallydeuteranomalydamageabilityanecdoticallydecarboxylasedecarboxylatedeclarativelydecasyllabicsdecasyllablesintradermallydevastatinglyexasperatedlystraitlacedlyadversativelyexaggeratedly
...View all with 13 letters...
Phrases (82)
el iskandriyahfamily laridaefamily picidaebattle of pydnaadmiralty milefamily bovidaedna polymeraseamyloid plaquebenzyl radicalfamily muridae
...View all with 13 letters...
Words (60)
understandablydemocraticallyidealisticallydepartmentallyadvantageouslyheavyheartedlygreatheartedlyupgradeabilitypsychoanalyzedadrenergicallyfaintheartedlypolyacrylamideencyclopaediasextrapyramidalclairaudientlydecarboxylasesdecarboxylateddecarboxylatesglutaraldehydecyanoethylatedhyaluronidasespolysaccharidebactericidallyplatinocyanideaddressabilitydiageneticallyunacademicallydodecasyllabicdodecasyllablecaryophyllidaemegalonychidaepsychoanalysedcynocephalidaelymphoadenomaspersuadability
...View all with 14 letters...
Phrases (132)
william tyndalefamily ardeidaeadmiralty metalfamily turdidaefamily vespidaefamily bothidaefamily bramidaedynamic balancefamily rallidaeurinary bladder
...View all with 14 letters...
Words (66)
extraordinarilylymphadenopathyaerodynamicallypolyunsaturateddispassionatelydemographicallyunadulteratedlyhydromechanicalpolysaccharidesautotetraploidyhydroxylapatitesuperabundantlyradiometricallytetramethylleadcoeducationallypolyacrylamidesdecarboxylationdecarboxylatingglutaraldehydesunanticipatedlyineradicabilityhemodynamicallyideographicallythermodynamicalallotetraploidyplatinocyanidesradiochemicallyradiotelegraphyhendecasyllabichendecasyllableextrajudiciallydisagreeabilityamaryllidaceousacidimetricallyhyperadrenalism
...View all with 15 letters...
Phrases (221)
charlotte cordayclass pelecypodadialysis machinefamily tinamidaeby trial and errorfamily leporidaefamily artamidaefamily astacidaefamily triglidaefamily lophiidae
...View all with 15 letters...
Words (26)
paraformaldehydeadministrativelydenominationallyindefatigabilitydecarboxylationsdodecaphonicallybiodegradabilityadenohypophysealadenohypophysialhyperlipoidaemiaphyllostomatidaehendecasyllabicshendecasyllablesundemocraticallyancylostomatidaepalaeodendrologytranscendentallyhydroxylapatitescalcium-cyanamidemelodramaticallycladogeneticallythelypteridaceaepaedogeneticallyununderstandablytetramethylleadslepidobotryaceaePhrases (185)
italian greyhoundfamily cyprinidaecardiac glycosidefamily locustidaefamily balaenidaeexemplary damagesfamily elateridaefamily blenniidaefamily pythonidaefamily buccinidae
...View all with 16 letters...
Words (8)
thermodynamicallycercidiphyllaceaeparaformaldehydeskaleidoscopicallyunderstandabilitylymphadenopathiesdisadvantageouslydialectologicallyPhrases (207)
class rhodophyceaefamily dasypodidaecylinder separatorfamily trochilidaefamily didelphidaecaesarian deliveryfamily droseraceaehexadecimal systemfamily engraulidaeafrican yellowwood
...View all with 17 letters...
Words (6)
lipopolysaccharidediethylmalonylureamucopolysaccharidehydrometallurgicalchlamydomonadaceaediethylcarbamazinePhrases (170)
family physeteridaefamily trichechidaefamily desmidiaceaemodal auxiliary verbmarquis de lafayettearthur garfield haysfamily meliphagidaeapodemus sylvaticusphoenix dactyliferafamily motacillidae
...View all with 18 letters...
Words (7)
mucopolysaccharideslipopolysaccharidesphenylthiocarbamideinterdepartmentallydiethylcarbamazinestetramethyldiarsineelectrocardiographyPhrases (181)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaefamily polypodiaceaehydrobates pelagicussubfamily perdicidaesolidarity surchargedisability insurance
...View all with 19 letters...
Words (5)
tetrahydrocannabinolradioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesencephalomyocarditisPhrases (177)
order mycelia steriliaorder myxobacterialesfamily trachipteridaedevelopmental anatomyclyde william tombaughfamily dermochelyidaesuricata tetradactylafamily pseudococcidaeambystomid salamanderclassifying adjective
...View all with 20 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (82)
hydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianbrachycome iberidifoliafamily branchiostomidaeedna saint vincent millayparliamentary procedurehenry engelhard steinway
...View all with 22 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (46)
subphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley masontechnology administrationfederal republic of germanysir charles leonard woolleyoxidative phosphorylation
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (30)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldcaulophyllum thalictroidessir arthur stanley eddingtonarab revolutionary brigadesnational academy of sciencesdevelopmentally challengedmachine readable dictionarysubfamily caesalpinioideaesecond law of thermodynamics
...View all with 25 letters...
Phrases (26)
brassica oleracea gongylodescharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumconjunctival layer of eyelidshereditary cerebellar ataxiascardinius erythrophthalmussuperorder labyrinthodontialeptodactylus pentadactylus
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (24)
american revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelsecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission system
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (11)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armynonsteroidal anti-inflammatoryeucalyptus maculata citriodorasocial security administrationmethamphetamine hydrochloridesubclass heterobasidiomycetestime-delay measuring instrument
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (14)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonmiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonfrancisco jose de goya y lucientessecondary sexual characteristic
...View all with 29 letters...
Phrases (11)
alexander isayevich solzhenitsyndepository financial institutionethylenediaminetetraacetic acidnontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusacute inclusion body encephalitisoccupational safety and health actunited states intelligence agency
...View all with 30 letters...
Phrases (11)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united statesadult respiratory distress syndrome
...View all with 32 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
