Words Containing: A,D,E,E,L,S,Y
(In Any Order)
There are 245 words,
773 phrases and
0 abbr's with
A,D,E,E,L,S,Y in.
Best Scoring Words With: A,D,E,E,L,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
adhesively | 10 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
sleepyhead | 10 | 19 | noun, adjectiven, adj | |||||
noun • a sleepy person | ||||||||
clepsydrae | 10 | 18 | nounn | |||||
noun • A water clock, especially as used in the ancient world. | ||||||||
aldehydes | 9 | 17 | nounn | |||||
noun • any of a class of highly reactive chemical compounds; used in making resins and dyes and organic acids | ||||||||
adversely | 9 | 16 | adverbadv | |||||
adverb • in an adverse manner | ||||||||
detestably | 10 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in an offensive and hateful manner | ||||||||
measuredly | 10 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a deliberate unhurried manner | ||||||||
parsleyed | 9 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
decayless | 9 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
desolately | 10 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in grief-stricken loneliness; without comforting circumstances or prospects | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (27)
desperatelypsychedeliawensleydaledeathlesslysleepyheadsendosteallyredisplayeddailynessesdreamlesslysedentarilydaisywheelsspiny-leafedspiny-leaveddodecastylepolypedatesincreasedlyscatteredlydestroyableyellowheadsdecussatelyunderlayersdelayeringsdisentrayledreadlesslysilky-leafedsilky-leavedplayleadersPhrases (9)
golden yearsdry cleanerslyme diseasedeems taylorleyte islandalfred noyessidereal daysedge familysheep gadflyWords (37)
regardlesslyrestrainedlyshamefacedlydecasyllabledisagreeablysoftheadedlydecreasinglypsychedeliashemodialysesdyeabilitiesadolescentlydrysalteriesindefeasiblyparaldehydeslycoperdalesfuraldehydesdemyelinatesheadmasterlygrassy-leafedgrassy-leavedsoreheadedlydodecastylescandescentlyglassyheadedunmeasuredlydispleasedlysynadelphiteleafy-stemmedladylikenessbaddeleyiteswensleydalesdisentrayleddisentraylessleepyheadedbreathalysed
...View all with 12 letters...
Phrases (11)
alfred kinseyfield soybeanseeded playerlee's birthdayfeudal systemorder bryaleslady's tressessaddle oystersidereal yearlibyan desert
...View all with 12 letters...
Words (39)
consideratelyembarrassedlyclandestinelysoftheartedlyencyclopediasunderstatedlysemilegendarydefeasibilitydecarboxylaseformaldehydesdecasyllablesexasperatedlyadversativelynearsightedlyunderlaymentsacetaldehydesbenzaldehydesresidentiallyyieldablenesssedimentarilydysmenorrhealundestroyablediethylamidesdiethylamineschalcedonyxessilvery-leafedsilvery-leavedsynadelphiteshaemodialyserhaemodialysescyclandelatesdetestabilitychrysomelidaepentadactylesendomycetales
...View all with 13 letters...
Phrases (23)
dna polymeraseclaude debussycelestial bodypays de la loirebissextile dayorder myrtalesvalentine's daygenus chelydralead by the nosedental surgery
...View all with 13 letters...
Words (37)
absentmindedlypolybutadienesunrestrainedlydiphenylaminesincandescentlystoutheartedlyrecrystallizedencyclopaediasdemyelinationsbutyraldehydespresidentiallydecarboxylasesdecarboxylateshydrocephaliestranscendentlyrecrystallisedsingle-handedlydodecasyllabledysmenorrhoealdispensativelymaldeploymentsdeclensionallyencyclopaedismencyclopaedisthyperpolarisedhaemodialyserssesquipedalityhaemodialyzersladylikenesseslecythidaceouspentadactyliesdimethylaminesperissodactylehyperdactyliestetradactylies
...View all with 14 letters...
Phrases (29)
moonseed familyfamily vespidaealfred tennysonorder cycadalesorder xyridalesgenus aleyrodesfamily soleidaeorder eubryalesdefense lawyersblack-eyed susan
...View all with 14 letters...
Words (33)
demonstrativelyinconsideratelypsychedelicallydishearteninglyhyperstimulatedhyperlipidemiaslymphadenitisesglutaraldehydesglyceraldehydeselectrodialyseselectrodialysiselectrodynamicsdephosphorylatehydrocephaluseshendecasyllabichendecasyllableindefeasibilitydisagreeabilityyieldablenessesencyclopaedismsencyclopaedistsdiesel-hydraulichyperadrenalismdodecasyllablesfurfuraldehydesaerohydroplanesdysteleologicaltyndallimetriesbutterfly-shapedlaryngectomisedconsiderativelyperissodactylesheterodactylousPhrases (46)
class pelecypodajohnny appleseedalexandre yersinthree-day measlesaloys senefeldercharles goodyearslender centauryslender lady palmlegislative bodytwo-year-old horse
...View all with 15 letters...
Words (9)
lyginopteridalesadenohypophysealmethylphenidateshendecasyllabicshendecasyllablesdephosphorylateddephosphorylatestranscendentallytetramethylleadsPhrases (49)
exemplary damageslaundry stiffenerisland of guernseyorder polygonalesgrand mal epilepsyrheims-douay biblescentless mayweedfamily serranidaemedical specialtyfamily passeridae
...View all with 16 letters...
Words (11)
paraformaldehydesdisrespectabilitylymphadenopathiesdehydrochlorinasedeoxyribonucleasedepolymerizationsone-dimensionalitydeterministicallyhydrometallurgiesundemonstrativelyeleutherodactylusPhrases (63)
class rhodophyceaecylinder separatorcaesarian deliveryfamily droseraceaehexadecimal systemmiles dewey davis jr.alexander kerenskydisability benefitorder thymelaealesacoustic delay line
...View all with 17 letters...
Words (7)
hyperaldosteronismcylindrical-stemmeddehydrochlorinasesdehydrochlorinatesdeoxyribonucleasessedimentologicallydimethylhydrazinesPhrases (69)
family physeteridaedame sybil thorndikefamily desmidiaceaemegacycle per secondmarquis de lafayetteamlodipine besylatedewey decimal systemalfred lord tennysonfamily centriscidaefamily scorpaenidae
...View all with 18 letters...
Words (7)
electrodynamometersthree-dimensionalityencephalomyelitidesdiethylcarbamazinestetramethyldiarsinedimethylnitrosaminedimethyltryptaminesPhrases (72)
family lepisosteidaehydrobates pelagicussubfamily perdicidaeedna st. vincent millaygerard manley hopkinsobstetrical deliveryfederal job safety lawcharles dudley warnerclass basidiomycetesdreissena polymorpha
...View all with 19 letters...
Words (3)
phenylthiocarbamidesencephalomyocarditisdimethylnitrosaminesPhrases (86)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily pseudococcidaeclassifying adjectivefriendly relationshiporder actinomycetalesclaude achille debussyfamily gasterosteidaeclarence shepard day jr.
...View all with 20 letters...
Words (1)
phosphoglyceraldehydePhrases (42)
aleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesptolemy ii philadelphussamuel taylor coleridgefederal security bureausuperfamily tyrannidaeorder lyginopteridalesyellow-eyed grass familyclustered lady's slipper
...View all with 21 letters...
Words (2)
phosphoglyceraldehydesencephalomyocarditisesPhrases (46)
aleksandr i. solzhenitsynathyrium thelypteroidesmale reproductive systemedna saint vincent millayhenry engelhard steinwaydisplaying incompetencedoctor of sacred theologyfederal security servicedepartment of philosophyfirst lord of the treasury
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (28)
alexandre emile jean yersinalfred edward woodley masonhenry wadsworth longfellowsir charles leonard woolleyhelen laura sumner woodburypaul johann ludwig von heyseel salvadoran monetary unitperfectly inelastic demandfamily plasmodiophoraceaeterrestrial dynamical time
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (27)
francis scott key fitzgeraldsir arthur stanley eddingtonreticuloendothelial systemarab revolutionary brigadesnational academy of sciencesdiesel-hydraulic locomotivesubfamily caesalpinioideaecomplementary distributionsecond law of thermodynamicscladorhyncus leucocephalum
...View all with 25 letters...
Phrases (21)
brassica oleracea gongylodescharles maurice de talleyrandbureau of diplomatic securitygilles de la tourette syndromeconjunctival layer of eyelidsdiethylaminoethyl cellulosesuperorder labyrinthodontialeptodactylus pentadactylusnontricyclic antidepressantclosed-end investment company
...View all with 26 letters...
Phrases (17)
aleksandr sergeyevich pushkincommissioned military officersecretary of commerce and labortricyclic antidepressant drugbaron lloyd webber of sydmontontopical prostaglandin eyedropsysteme international d'unitesmetasequoia glyptostrodoidesu.s. national library of medicinethermodynamics of equilibrium
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (9)
aleksandr feodorovich kerenskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulosefield-sequential color tv systempan troglodytes schweinfurthiisubclass heterobasidiomycetestime-delay measuring instrumentPhrases (15)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disordermiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonfrancisco jose de goya y lucientespressure-feed lubricating systemsecondary sexual characteristicalfred habdank skarbek korzybski
...View all with 29 letters...
Phrases (11)
alexander isayevich solzhenitsynmucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsbasic point defense missile systemdisseminated lupus erythematosusacute inclusion body encephalitisoccupational safety and health actunited states intelligence agency
...View all with 30 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay