Words Containing: A,C,I,N,T,H,S
(In Any Order)
There are 1,311 words,
1,828 phrases and
0 abbr's with
A,C,I,N,T,H,S in.
Best Scoring Words With: A,C,I,N,T,H,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pickthanks | 10 | 25 | verb, noun, adjectivev, n, adj | |||||
Valid word for Scrabble US
| ||||||||
hoactzines | 10 | 24 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
hoactzins | 9 | 23 | nounn | |||||
noun • crested ill-smelling South American bird whose young have claws on the first and second digits of the wings | ||||||||
mackintosh | 10 | 21 | nounn | |||||
noun • a lightweight waterproof (usually rubberized) fabric • a waterproof raincoat made of rubberized fabric | ||||||||
jacinthes | 9 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
hyacinths | 9 | 20 | nounn | |||||
noun • a red transparent variety of zircon used as a gemstone • any of numerous bulbous perennial herbs | ||||||||
myasthenic | 10 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
jacinths | 8 | 20 | nounn | |||||
noun • a red transparent variety of zircon used as a gemstone | ||||||||
whinchats | 9 | 20 | nounn | |||||
noun • brown-and-buff European songbird of grassy meadows | ||||||||
scathingly | 10 | 19 | adverb, adjectiveadv, adj | |||||
adverb • in a scathing and unsparing manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (57)
christiananarchistmacintoshmachinisthesitancystanchionhesitancehanseaticstarchingmechaniststanchingteachingscathepsinkatchinaschanciestsnatchierchinstrapsnatchingcantharisyachtingscanthitistachinidscashpointhyacinthschantriesthincladscatechinsjacinthesswitchmanchitosanswhinchatstrichinasnightcapsantishockethicians
...View all with 9 letters...
Phrases (3)
skin patchchest painchin strapWords (90)
scratchinganestheticantichristchauvinistscathinglyhumanisticmonarchistmackintoshchastisingchasteningdisenchantphantasmicmachinistschieftainspatchinessanarchistsmechanistsunchastityraunchiesthesitancesbranchieststanchionsanchoritesstomachinghatchlingscathepsinsunactorishescheatingsnatchiestthatchingschinstrapschromatinsepicanthusrevanchistmachinates
...View all with 10 letters...
Phrases (8)
chain storechain tongsswitch canest. nicholaslancet fishfinish coatchina asterchina stoneWords (138)
anaestheticpantheisticcholangitisanarchisticcarpathiansunchristiancaptainshipsycophanticchristianiashamanisticunaestheticmechanisticestheticianharmonicistanthracitescohabitantsdispatchingcachinnatescharmingeststarchinessmachinatorstechniciansmyasthenicsanestheticsdisenchantscatechisingthrasonicaldespatchinghesitanciesbatrachiansstanchionedethicalnessmonarchistschauvinistsstickhandle
...View all with 11 letters...
Phrases (18)
tennis coachsection handcanis anthusseat cushionethics panelscratch linechinese datechain stitchtennis matchwaist anchor
...View all with 11 letters...
Words (177)
christianityenthusiasticchauvinisticencephalitiscalisthenicsanaestheticsdisenchantedstenographicgemeinschaftneurastheniccharlatanismchastisementmisanthropicaestheticianstickhandledstickhandlesschematizingimpeachmentsunhystericalhallucinatesmachinationsinchoatenesschanticleerschiropteranssycophantismunchastitiesphonotacticskitchenwarescartoonishlyachievementstrichomonadsstickhandlerinterchangesinheritancesharmonicists
...View all with 12 letters...
Phrases (39)
captain hickshandling costman's clothinggenus tarichaanimal starchauction housecanister shotshopping cartwashington d.c.white arsenic
...View all with 12 letters...
Words (203)
craftsmanshiplaughingstockorchestratingunsympatheticantipsychoticanachronisticcustodianshiptransthoracicthoracentesisorchestrationsyntheticallyterpsichoreandisenchantingshortchangingchristianizedchieftainshipcontainershipphagocytosingcrosshatchingphotoscanningtheoreticiansanalphabeticscharlatanismspantechniconsschismatizingnonarchitectsauthenticatesopisthobranchblacksmithinguncharismatictechnophobiasnonhystericalthrasonicallychastisementsarchegoniates
...View all with 13 letters...
Phrases (61)
frances wrightsandwich platemachine stitchii corinthiansmonastic habitcontainer shipgenus hepaticadanish capitalfirst harmonicpiston chamber
...View all with 13 letters...
Words (239)
accomplishmentsophisticationapprenticeshipthermodynamicscholinesterasepsychoanalyticschoolteachingnarcosynthesisunenthusiasticdisenchantmentcharacterisingdisinheritancearchitectonicsmethodicalnessmonochromatismantiphlogisticlithificationsmachicolationscanthaxanthinshandicraftsmanhandicraftsmenbronchiectasestechnicalitiesinchoatenessescinematographsmetaphysiciansantihistaminicauthenticatorsauthenticitiesmathematiciansblacksmithingshedonisticallymechanizationsantirheumaticssycophantishly
...View all with 14 letters...
Phrases (72)
breathing spacecastle in the airgaston lachaisebristol channelchinese lanternbritish cabinetmale chauvinistchicken scratchachromatic lenschief assistant
...View all with 14 letters...
Words (187)
synchronizationpithecanthropusunsophisticatedinterscholasticsynchronisationenfranchisementplainclothesmanneuropsychiatrykinestheticallyphosphocreatineaccomplishmentsechinodermatousnonachievementsschematizationstrisoctahedronsbronchodilatorsantiaphrodisiacauthenticationsantihistaminicsdisenchantinglytranshistoricalpsychohistoriansycophanticallypsychometriciancyproheptadinesanticholesterolorchestrationalcholinesterasesapprenticeshipsreorchestratingreorchestrationdisinheritanceshumidificationsphenomenalisticchangeabilities
...View all with 15 letters...
Phrases (119)
italian sandwichathletic contestacross the nationernst boris chainmythical monsteranesthetic agentchromatic visiontragulus kanchilcairina moschatasalix sitchensis
...View all with 15 letters...
Words (81)
enthusiasticallypsychoanalyticaluncharacteristiccharacterisationoverenthusiasticacquaintanceshipneuropsychiatricantistrophicallyantitechnologieschristianisationpostencephaliticchristianizationnonpsychiatriststhyrocalcitoninsarchconservativemonotheisticallyfeatherstitchingphantasmagoricalunsophisticationanthropocentrismstenographicallyuntouchabilitiesstereophonicallycyanoethylationshippocastanaceaemachineabilitiespharmacogeneticskinaestheticallypharmacokineticslymphangiectasialymphangiectasisfrenchificationsanti-aestheticismnanotechnologiesconservatorships
...View all with 16 letters...
Phrases (134)
manihot esculentachristian huygenscaptain john smithochotona princepschain of mountainssir richard burtontendon of achillescatholic monarchsphotostat machinespoonbill catfish
...View all with 16 letters...
Words (48)
nonmathematiciansantischizophreniaantischizophrenicleukoencephalitisdisfranchisementsthrombocytopeniascrashworthinessesarchconservativesunsophisticationsencephalomyelitiscontradistinguishstraightjacketingbacteriorhodopsinpharmacognosticaltransthoracicallydehumidificationsacquaintanceshipsbiomathematiciansmechanoreceptionsneuropsychiatriesneuropsychiatristmerchantabilitieshandcraftsmanshipunsympatheticallyphotocoagulationsdesynchronisationdesynchronizationphotodissociatingphotodissociationphotoduplicationsanthropocentrismsanachronisticallyphotojournalisticcharacterizationssaccharifications
...View all with 17 letters...
Phrases (159)
horizontal sectionacherontia atropossubphylum craniataantipsychotic drugorder ornithischiacalycanthus familytrichechus manatuspython reticulatuschristopher carsonfashion collection
...View all with 17 letters...
Words (24)
disenfranchisementmonochromaticitiesarchaeoastronomiespostpsychoanalyticaustralopithecinesbacteriorhodopsinscharacteristicnessdehydrochlorinatesmechanochemistriesaerothermodynamicsneuropsychiatristshandcraftsmanshipsanticholinesterasephotodissociationsphotoreactivationschlortetracyclinesuncharitablenessespsychoanalyticallyphotosyntheticallycytoarchitectonicsethnomusicologicalunenthusiasticallyhypernationalistictheatricalizationsPhrases (154)
lachrymal secretionantipsychotic agentnational censorshipgenus chamaecytisuschemical operationsascension of the lordkamchatka peninsulaoscar hammerstein iiarthur m. schlesingeraccordance of rights
...View all with 18 letters...
Words (26)
disenfranchisementsencephalomeningitisresorcinolphthaleinanarcho-collectivismcytopathogenicitiesimmunohistochemicalphenomenalisticallypseudohallucinationphosphatidylcholinephosphofructokinaseneuropharmacologistcontradistinguishedcontradistinguishesmeningoencephalitiselectroretinographsencephalomyelitidesunapproachabilitiesanticholinesterasesphotoreconnaissancediethylcarbamazinesinterchangeablenesshyperconcentrationshypoadrenocorticismphacoemulsificationexhibitionisticallymischaracterizationPhrases (155)
hydrastis canadensisgiles lytton stracheydivision schizophytacaesalpinia echinatacapital of kazakhstanstephen michael reichcalycanthus floriduschinese monetary unitbritish capacity unituniversity of chicago
...View all with 19 letters...
Words (21)
uncharacteristicallyoverenthusiasticallyhyperadrenocorticismphenylthiocarbamidesinterchangeabilitiesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneuropsychiatricallycontradistinguishingmagnetohydrodynamicshistoincompatibilityanthropocentricitiesencephalomyocarditispseudocholinesterasephotoreconnaissancespseudosophisticationmischaracterizationsPhrases (144)
photographic emulsiondivision tracheophytabalance sheet analysisdianthus caryophyllusislamic calendar monthrepublic of kazakhstanernst heinrich haeckelcantharellus cibariussouth american countryatmospheric condition
...View all with 20 letters...
Words (8)
interchangeablenessesacetylcholinesterasesadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasespseudosophisticationstetrahydrocannabinolsPhrases (131)
acrocentric chromosomehelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumphilosophical doctrinetelephone conversationzonotrichia albicollistransmission mechanismcapital of new hampshirephascolarctos cinereus
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (131)
viola tricolor hortensisteacher-student relationfrancis richard stocktoncapital of liechtensteinrhythm and blues musicianpartnership certificateivan sergeevich turgenevcharacter assassinationarthur meier schlesingerfamily branchiostomidae
...View all with 22 letters...
Words (3)
laryngotracheobronchitiselectroencephalographiesdichlorodifluoromethanesPhrases (66)
trip the light fantastic toearthur meier schlesinger jr.gioacchino antonio rossinirichard buckminster fullertechnology administrationcomprehensive examinationhypersensitivity reactioncharles augustus lindberghcharles camille saint-saensbattle of chancellorsville
...View all with 24 letters...
Phrases (72)
igor fyodorovich stravinskybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionherpes simplex encephalitisandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (48)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidbacon-lettuce-tomato sandwichhunting and gathering societywar of the austrian successionanton grigorevich rubinsteinjames abbott mcneill whistler
...View all with 26 letters...
Phrases (30)
nikita sergeyevich khrushchevelectromechanical transducerdirector-stockholder relationjerusalem artichoke sunflowercryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulusthrough empirical observation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (38)
marcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdepartment of homeland securitygrace ethel cecile rosalie allensergei mikhailovich eisensteincongregation of the inquisitiondissident irish republican army
...View all with 28 letters...
Phrases (24)
chemical decomposition reactiondisorganized type schizophreniasouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitcongregational christian churchhydrangea macrophylla hortensisconstitution of the united statessecond epistle to the corinthiansgeorges joseph christian simenon
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedenttechnical analysis of stock trendssisters of st. michael the archangel
...View all with 30 letters...
Phrases (19)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologyfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouart
...View all with 31 letters...
Phrases (9)
hierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationtheory of electrolytic dissociationedmond louis antoine huot de goncourtyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosischrysanthemum coronarium spatiosumamaranthus hybridus erythrostachysPhrases (16)
breach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nationsbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadetransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing