Words Containing: A,C,I,L,L,S,Y
(In Any Order)
There are 835 words,
675 phrases and
0 abbr's with
A,C,I,L,L,S,Y in.
Best Scoring Words With: A,C,I,L,L,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
physically | 10 | 23 | adverb, adjectiveadv, adj | |||||
adverb • in accord with physical laws | ||||||||
mystically | 10 | 20 | adverb, adjectiveadv, adj | |||||
adverb • in a mystical manner | ||||||||
cosmically | 10 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
symbolical | 10 | 19 | adjectiveadj | |||||
adjective • relating to or using or proceeding by means of symbols adjective satellite • serving as a visible symbol for something abstract | ||||||||
clannishly | 10 | 18 | adverbadv | |||||
adverb • in a clannish manner | ||||||||
disyllabic | 10 | 18 | adjectiveadj | |||||
adjective satellite • having or characterized by or consisting of two syllables | ||||||||
cyclicals | 9 | 18 | nounn | |||||
adjective • recurring in cycles | ||||||||
viscerally | 10 | 18 | adverbadv | |||||
adverb • in an unreasoning visceral manner • in the viscera | ||||||||
especially | 10 | 17 | adverbadv | |||||
adverb • to a distinctly greater extent or degree than is common • in a special manner | ||||||||
miscellany | 10 | 17 | nounn | |||||
noun • a collection containing a variety of sorts of things • an anthology of short literary pieces and poems and ballads etc. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (27)
especiallyphysicallysurgicallycosmicallysalicylatesuicidallymysticallysymbolicalmiscellanysocietallyscenicallystericallymosaicallyunsociallyclannishlydisyllabicstaticallyviscerallyrusticallyzircalloysblackishlyunsyllabicsalicylismsyllabicalsepticallysynclinalsclashinglyPhrases (3)
chalcis flylucius claychild's playWords (66)
drasticallycrystallineclassicallymaliciouslysphericallypsychicallycrystalloidcrystallizeskepticallyscepticallywhimsicallycausticallysalaciouslycrystallisespasticallyelasticallysatanicallyplasticallycelestiallycrystalliteencyclicalsplasmolyticnonsyllabicasceticallymasculinelytrisyllabicoscillatorybiosociallyosmoticallysomaticallyprosaicallylyricalnessdeisticallysatiricallysectionally
...View all with 11 letters...
Phrases (3)
lucius d. clayhay bacilluslychnis albaWords (105)
specificallyoccasionallymiraculouslyhistoricallyhystericallysymbolicallyartisticallycrystallizeddomesticallymonosyllabicpolysyllabicforensicallysporadicallymajesticallylasciviouslysadisticallylogisticallyecstaticallycalamitouslyinconsolablyacousticallycrystallisedcosmeticallyestheticallyscripturallyloquaciouslychivalrouslyclassicalityholisticallyseraphicallyegoisticallyesotericallysystemicallyfallaciouslygeosynclinal
...View all with 12 letters...
Phrases (10)
scantily cladmusical styleresidual clayturk's cap-lilygenus cyrillasocial policysalt lake cityblack salsifyfiscal policyacris gryllusWords (146)
psychologicalstatisticallyfantasticallyphysiologicalrealisticallystrategicallysarcasticallysuperficiallyaestheticallysymmetricallyintrinsicallysyntheticallydisgracefullycrystallizinglymphoblasticrhapsodicallypolydactylismnostalgicallyspasmodicallysyntacticallystylisticallyclandestinelyinstinctuallysymbioticallyegotisticallybombasticallygymnasticallyimagisticallysacrificiallypietisticallyunmaliciouslyextrinsicallyatomisticallydyspepticallypharisaically
...View all with 13 letters...
Phrases (16)
celestial bodyvachel lindsayfocal epilepsysalicylic acidliquid crystalalloy cast ironeucalyptus oilcurly clematiscelestial cityscilly islands
...View all with 13 letters...
Words (140)
scientificallysystematicallylinguisticallymetaphysicallysociologicallyscholasticallyoptimisticallyastronomicallysimplisticallyidealisticallyaltruisticallydiagnosticallyastrologicallydisconsolatelyasymmetricallynoncrystallinesupersonicallyprocessionallymoralisticallysemiofficiallystochasticallyparadisiacallyhedonisticallysacrilegiouslyallostericallyhistrionicallyantisepticallysuccessionallyunchivalrouslypleonasticallynovelisticallypacifisticallyhumanisticallyeulogisticallyaphoristically
...View all with 14 letters...
Phrases (17)
classical stylemost especiallycitellus parryicrystal latticechimney swallowclubmoss familyclass lycopsidasonic delay lineviola sylvaticachristmas holly
...View all with 14 letters...
Words (146)
psychologicallyphysiologicallyphilosophicallysynergisticallycrystallizationmicroscopicallycontroversiallyrecrystallizinglackadaisicallygastronomicallyseismologicallysympatheticallyeuphemisticallyritualisticallypessimisticallypsychiatricallyvoyeuristicallykinestheticallyunsymmetricallynonspecificallypsychedelicallysymptomaticallysycophanticallysocioculturallyelectroanalysisconsequentiallysyllogisticallycompositionallypolycrystallineintravascularlyunrealisticallysemicylindricalionosphericallypolyacrylamidesstereologically
...View all with 15 letters...
Phrases (29)
genus bombycillalouisa may alcottlymphatic vesselpolitical systemphysical abilitywilliam shockleyspecial deliveryspecial olympicsfamily loasaceaeleprosy bacillus
...View all with 15 letters...
Words (67)
enthusiasticallyconstitutionallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallymonosyllabicallythermostaticallysurrealisticallypsychobiologicalconversationallyjurisdictionallyantistrophicallyparaphrasticallypolysynapticallycommonsensicallypositivisticallyhypocoristicallymonopolisticallynonpsychologicalmonosynapticallymonotheisticallyarchiepiscopallyiconoclasticallycrystallizationsstenographicallycrystallographicpostsynapticallystereophonicallyecclesiasticallyasymptomaticallycyclohexylaminesperiphrasticallyfluoroscopicallystereoscopically
...View all with 16 letters...
Phrases (48)
chemical analysisfamily locustidaecarya illinoensiscarya illinoinsissalivary calculussea-lettuce familyarctonyx collarismonosyllabic wordcortical epilepsymedical specialty
...View all with 16 letters...
Words (42)
materialisticallyelectrostaticallyinconsequentiallysocioeconomicallymultidisciplinaryprobabilisticallyisoelectronicallykaleidoscopicallyradioisotopicallyparasitologicallyspectroscopicallyrationalisticallymonosyllabicitiespaternalisticallycryptocrystallineidiosyncraticallyencephalomyelitiscrystallographiesillusionisticallytranscriptionallyuncontroversiallyrecrystallizationnationalisticallytransthoracicallyopportunisticallyacetylsalicylatesglycosaminoglycanimperialisticallyunsympatheticallymetapsychologicalanachronisticallyparapsychologicaldeterministicallyschizophrenicallyepistemologically
...View all with 17 letters...
Phrases (50)
salvia leucophyllatheological systemcalycanthus familycapital of malaysiamutually exclusivecult of personalityacoustic delay lineharry lillis crosbysoldier grainy clubcarnot's ideal cycle
...View all with 17 letters...
Words (31)
characteristicallypsychopathologicalsociopsychologicalneuropsychologicalpathophysiologicalcylindrical-stemmedlipopolysaccharideunconstitutionallystereospecificallystoichiometricallyrecrystallizationssubmicroscopicallyglycosaminoglycansoscillographicallyspectrographicallymicrocrystallinitypropagandisticallyhistophysiologicalchlortetracyclinespsychoanalyticallysedimentologicallyphotosyntheticallyoveroptimisticallyphysiopathologicaltachistoscopicallyunenthusiasticallyneurophysiologicalclaustrophobicallysomnambulisticallypolyacrylonitrilescollectivisticallyPhrases (63)
bombycilla garruluslachrymal secretionarchitectural stylefamily salviniaceaeliability insurancefamily scolopacidaedigitalis glycosidecyrus hall mccormickancylus fluviatilissexually attractive
...View all with 18 letters...
Words (20)
psychophysiologicalextralinguisticallycrosslinguisticallynonrelativisticallylipopolysaccharidesconceptualisticallyindividualisticallyphenomenalisticallyphosphatidylcholinecross-linguisticallyimpressionisticallyencephalomyelitideshistopathologicallyhistoriographicallysymptomatologicallysociolinguisticallypsychotomimeticallyexhibitionisticallyexpressionisticallypolychromatophiliasPhrases (65)
acetylsalicylic acidfamily cynoglossidaegiles lytton stracheycalycanthus floridussalicylate poisoningcapital of seychellesedna st. vincent millaycholoepus didactyluspolitical sympathiesobstetrical delivery
...View all with 19 letters...
Words (17)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallycrystallographicallybacteriochlorophyllsacetylcholinesterasephosphatidylcholinesneurophysiologicallyneuropsychiatricallyultramicroscopicallyelectrophysiologicalmicrocrystallinitiespsychopathologicallysyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyPhrases (70)
yellow-shafted flickerwyethia amplexicaulisorder mycelia steriliaoryctolagus cuniculusbalance sheet analysisdianthus caryophyllusmechanically skillfulclaude achille debussynymphicus hollandicuspass with flying colors
...View all with 20 letters...
Words (6)
psychopharmacologicalstereomicroscopicallyacetylcholinesteraseshypercholesterolemiaspsychophysiologicallypsychotherapeuticallyPhrases (49)
cynoglossum officinalecapital of pennsylvaniasamuel taylor coleridgearticulatio synovialisagricultural chemistryfamily grossulariaceaephysalis philadelphicawilliam holmes mcguffeyphysical impossibilityphysiological property
...View all with 21 letters...
Words (2)
spectrophotometricallyelectrophysiologicallyPhrases (54)
haliaeetus leucorhyphusloyalist volunteer forceedna saint vincent millayseychelles monetary unitwater of crystallizationphysical rehabilitationharvery williams cushingmary ludwig hays mccauleyperfectly elastic demandperfectly elastic supply
...View all with 22 letters...
Phrases (28)
carnegie mellon universitymary wollstonecraft godwinsir charles leonard woolleyelectroconvulsive therapysuperior cerebellar arteryperfectly inelastic demandconstitutional psychologyfamily plasmodiophoraceaepityrogramma chrysophyllaterrestrial dynamical time
...View all with 24 letters...
Phrases (17)
caulophyllum thalictroidesanthony charles lynton blairtympanuchus pallidicinctusembryonic stem-cell researchreticuloendothelial systemspecial theory of relativitydiesel-hydraulic locomotivesubfamily caesalpinioideaepelvic inflammatory diseaseinclusion body encephalitis
...View all with 25 letters...
Phrases (16)
brassica oleracea gongylodesemployee stock ownership plancharles maurice de talleyrandmyrtillocactus geometrizansconjunctival layer of eyelidscalycophyllum candidissimumdiethylaminoethyl cellulosecalifornia single-leaf pinyonphyllocladus trichomanoidesdewey decimal classification
...View all with 26 letters...
Phrases (17)
nuclear regulatory commissioncryptobranchus alleganiensisprincipality of liechtensteinhyacinthus orientalis albulustopical prostaglandin eyedropnikolai ivanovich lobachevskyuniversity of nebraska-lincolnhypothalamic releasing factorpolyostotic fibrous dysplasiadactylorhiza maculata fuchsii
...View all with 27 letters...
Phrases (14)
revolutionary communist leaguecount lev nikolayevitch tolstoysmall computer system interfacesodium carboxymethyl cellulosecygnus columbianus columbianushypothalamic releasing hormonefield-sequential color tv systemeucalyptus maculata citriodoramilitary intelligence section 5military intelligence section 6
...View all with 28 letters...
Phrases (10)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderhydrangea macrophylla hortensisultrasonic pulse velocity testeranonymous file transfer protocolcypripedium calceolus pubescensdecimal system of classificationthelypteris palustris pubescensvyacheslav mikhailovich molotovPhrases (13)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencebalance of international paymentscalymmatobacterium granulomatiscalifornia personality inventorytechnical analysis of stock trendsprovisional irish republican army
...View all with 30 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay