Words Containing: A,C,E,H,I,N,S
(In Any Order)
There are 1,395 words,
2,267 phrases and
0 abbr's with
A,C,E,H,I,N,S in.
Best Scoring Words With: A,C,E,H,I,N,S
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | mechanizes | 10 | 26 | verbv | |||
2 | scherzandi | 10 | 25 | ||||
3 | hawfinches | 10 | 24 | nounn | |||
4 | hoactzines | 10 | 24 | noun, adjectiven, adj | |||
5 | hackneyism | 10 | 24 | nounn | |||
6 | anarchizes | 10 | 24 | ||||
7 | chronaxies | 10 | 22 | ||||
8 | jacinthes | 9 | 21 | ||||
9 | shankpiece | 10 | 21 | nounn | |||
10 | rainchecks | 10 | 21 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (48)
searching15mechanics18mechanism18franchise17cavendish18hesitancy17hesitance14mischance18hanseatic14chariness14selachian14mechanist16shanachie17teachings15cathepsin16sennachie14chicaners16spinaches16chanciest16haciendas15snatchier14encashing15chantries14anarchies14enchasing15catechins16jacinthes21chasseing15camphines18icekhanas18ethicians14anchovies17cephalins16asthenics14vacherins17
...View all with 9 letters...
Phrases (3)
china rosesea urchinchest painWords (121)
anesthetic15lancashiremechanised18saccharine17schliemannfranchised19chanceries17deaconship18chastening16disenchant16chanciness17selachians15gynarchies19mischannel17chieftains18patchiness17hindrances16mechanisms19mechanists17sandwiched20mechanizes26sandwiches19shanachies18raunchiest15hesitances15branchiest17anchorites15monarchies17chelonians15achinesses15cathepsins17chinawares18franchiser18franchises18sennachies15
...View all with 10 letters...
Phrases (9)
slim chancesedan chairchain storechinese yamswitch canesquare inchlancet fishchina asterchina stoneWords (177)
merchandise19anaesthetic16pantheistic18chairperson18marchioness18unaesthetic16mechanistic20esthetician16graphicness19shellacking21paunchiness18chicaneries18spinachlike22chaffinches27anthracites16changelings18cachinnates18charmingest19chainwheels22starchiness16chansonnier16technicians18cacophonies20myasthenics21anesthetics16disenchants17catechising19preachiness18neophiliacs18researching17despatching20raunchiness16searchingly20hesitancies16archenemies18
...View all with 11 letters...
Phrases (26)
chinese walltennis coachsection handseat cushionethics panelscratch lineracing shellischial bonechinese datemachine shop
...View all with 11 letters...
Words (207)
enthusiastic17speechmaking26encephalitis19calisthenics19merchandiser20anaesthetics17disenchanted19undischarged20stenographic20packinghouse24braunschweiggemeinschaft23neurasthenic17chastisement19enfranchised21merchandised21clannishness17disfranchise21aesthetician17physicalness22stickhandled23stickhandles22schematizing29impeachments23unhysterical20hallucinates17handicappers22icosahedrons18candlefishes21chairpersons19chansonniers17mischanneled20inchoateness17chanticleers19scrimshander20
...View all with 12 letters...
Phrases (49)
chinese anisegenus tarichagenus arachisanise camphorsciaenid fishbasic englishauction housecanister shotgenus inachiswhite arsenic
...View all with 12 letters...
Words (233)
schizophrenia32merchandising22orchestrating19unsympathetic25housecleaning19thoracentesis18orchestration18synthetically24sharecropping23terpsichorean20disenchanting20affenpinscher26christianized28chieftainship26aeromechanics22containership20disfranchised23commandership25disfranchises22theoreticians18iconographers21analphabetics22iconographies21pantechnicons22hallucinogens19mischanneling21mischannelled21handkerchiefs29nonarchitects20authenticates18chalcogenides22technophobias25nonhysterical21chastisements20archegoniates19
...View all with 13 letters...
Phrases (86)
harvey cushingchannel islandfrances wrightephedra sinicaspecial branchsandwich platemachine stitchgenus achilleamexican hyssopcontainer ship
...View all with 13 letters...
Words (216)
accomplishment27apprenticeship25thermodynamics27cholinesterase19schoolteaching25narcosynthesis22unenthusiastic19unaccomplished26disenchantment22disenfranchise23mechanicalness23characterising22disinheritance20servomechanism26architectonics23monosaccharide24unchangingness21methodicalness22oceanographies22hypermasculine26braunschweiger25handicraftsmen25bronchiectases23technicalities21mischannelling22inchoatenesses19cinematographs24metaphysicians26authenticators19authenticities19mathematicians23hedonistically23mechanizations30underachievers23antirheumatics21
...View all with 14 letters...
Phrases (130)
breathing spacecastle in the airgaston lachaisefrancis joseph ibristol channelchinese lanternbritish cabinetmale chauvinistchicken scratchchinese parsley
...View all with 14 letters...
Words (170)
pithecanthropus27unsophisticated23disenfranchised25czechoslovakianinterscholastic22enfranchisement25plainclothesman24neuropsychiatry28kinesthetically27phosphocreatine27accomplishments28echinodermatous23nonachievements25schematizations31trisoctahedrons21chlorpromazines33authentications20disenchantingly25psychometrician29cyproheptadines28anticholesterol20servomechanisms27orchestrational20monosaccharides25hypervigilances29cholinesterases20apprenticeships26reorchestrating21reorchestration20chancellorships27ionospherically25disinheritances21phenomenalistic24changeabilities23chemotaxonomies31
...View all with 15 letters...
Phrases (187)
high renaissancedialysis machineathletic contesthyoscyamus nigerpinchas zukermanchemical defenseacross the nationgenus charadriusernst boris chainchemical science
...View all with 15 letters...
Words (70)
enthusiasticallyuncharacteristiccharacterisationoverenthusiasticacquaintanceshipneuropsychiatricdisenfranchisingantitechnologiesmachiavellianismpostencephaliticarchconservativemonotheisticallyfeatherstitchinganthropocentrismstenographicallyuntouchabilitiesstereophonicallycyanoethylationscyclohexylamineshippocastanaceaemachineabilitiespharmacogeneticskinaestheticallypharmacokineticslymphangiectasialymphangiectasisfrenchificationsanti-aestheticismnanotechnologiesconservatorshipsinterchromosomalacetophenetidinsneurasthenicallymechanochemistrybiosynthetically
...View all with 16 letters...
Phrases (190)
manihot esculentadelphinium ajacischristian huygensochotona princepschemical analysisfacsimile machinetendon of achillesphotostat machinechristmas presentgenus cheilanthes
...View all with 16 letters...
Words (46)
nonmathematiciansantischizophreniaantischizophrenicleukoencephalitisdisfranchisementsthrombocytopeniascrashworthinessesarchconservativesphilosophicalnessencephalomyelitismachine-accessiblestraightjacketingpharisaicalnessesbacteriorhodopsindehumidificationsdehydrochlorinaseacquaintanceshipsbiomathematiciansmechanoreceptionsneuropsychiatriesneuropsychiatristmerchantabilitiesunsympatheticallybronchopneumoniasdesynchronisationdesynchronizationanthropocentrismscharacterizationsrhynchocephaliansencephalographiesaustralopithecinetracheobronchitisunchangeabilitiescholangiographiesschizophrenically
...View all with 17 letters...
Phrases (204)
horizontal sectiongenus globicephalaacherontia atroposhandicapped personprimary censorshiporder ornithischialine of merchandiselouisiana purchasechemical mechanismtrichechus manatus
...View all with 17 letters...
Words (25)
disenfranchisementneuropsychologicalmonochromaticitiesarchaeoastronomiesaustralopithecinesbacteriorhodopsinscharacteristicnessdehydrochlorinasesdehydrochlorinatesmechanochemistriesaerothermodynamicsneuropsychiatristsanticholinesteraseorder-chenopodialesphotoreactivationschlortetracyclinesuncharitablenessesphotosyntheticallycytoarchitectonicsethnomusicologicalunenthusiasticallyneurophysiologicalirreproachablenesshypernationalistictheatricalizationsPhrases (208)
lachrymal secretionfreudian psychologyantipsychotic agentnational censorshipgenus chamaecytisusrepublic of honduraschemical operationsascension of the lordkamchatka peninsulaoscar hammerstein ii
...View all with 18 letters...
Words (29)
disenfranchisementsencephalomeningitisresorcinolphthaleinanarcho-collectivismcytopathogenicitiesimmunohistochemicalphenomenalisticallypseudohallucinationphonocardiographiesphosphatidylcholineneuropharmacologiesphosphofructokinaseneuropharmacologistcontradistinguishedcontradistinguishesmeningoencephalitisangiocardiographieselectroretinographsencephalomyelitidesunapproachabilitiesanticholinesterasesphotoreconnaissancediethylcarbamazinesinterchangeablenesshyperconcentrationshypoadrenocorticismphacoemulsificationexhibitionisticallymischaracterizationPhrases (174)
hydrastis canadensisallium schoenoprasumgiles lytton stracheygenus symphoricarposcaesalpinia echinatapounds per square inchstephen michael reichirish gaelic languagechinese monetary unitgenus branchiobdella
...View all with 19 letters...
Words (23)
uncharacteristicallyoverenthusiasticallyparadichlorobenzeneshyperadrenocorticismphenylthiocarbamidesinterchangeabilitiesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneurophysiologicallyneuropsychiatricallymagnetohydrodynamicsanthropocentricitiesencephalomyocarditispseudocholinesterasephotoreconnaissancespseudosophisticationnephroangiosclerosisirreproachablenessesmischaracterizationsPhrases (155)
archeological remainsphotographic emulsiondivision tracheophytabalance sheet analysissphenisciform seabirdislamic calendar monthrepublic of kazakhstanernst heinrich haeckelcantharellus cibariusmechanically skillful
...View all with 20 letters...
Words (8)
interchangeablenessesacetylcholinesterasesadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasespseudosophisticationstetrahydrocannabinolsPhrases (144)
acrocentric chromosomehelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumphilosophical doctrinetelephone conversationtransmission mechanismcapital of new hampshirephascolarctos cinereusmathematical statement
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (145)
leishmaniasis americanaviola tricolor hortensisteacher-student relationcapital of liechtensteinrhythm and blues musicianpartnership certificatefrancois charles mauriacivan sergeevich turgenevcharacter assassinationarthur meier schlesinger
...View all with 22 letters...
Words (3)
laryngotracheobronchitiselectroencephalographiesdichlorodifluoromethanesPhrases (79)
argyroxiphium sandwicensetrip the light fantastic toearthur meier schlesinger jr.richard buckminster fullertechnology administrationcomprehensive examinationhypersensitivity reactioncharles augustus lindberghcharles camille saint-saensalgernon charles swinburne
...View all with 24 letters...
Phrases (76)
battle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionherpes simplex encephalitischarles frederick menningerandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (52)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidbacon-lettuce-tomato sandwichhunting and gathering societywar of the austrian successionanton grigorevich rubinsteinjames abbott mcneill whistler
...View all with 26 letters...
Phrases (39)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinelectromechanical transducerdirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunflowercryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdepartment of homeland securitygrace ethel cecile rosalie allensergei mikhailovich eisenstein
...View all with 28 letters...
Phrases (28)
aleksandr nikolayevich scriabinchemical decomposition reactiondisorganized type schizophreniasouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitcongregational christian churchhydrangea macrophylla hortensisconstitution of the united statessecond epistle to the corinthians
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedent
...View all with 30 letters...
Phrases (21)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologysir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Phrases (12)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovtheory of electrolytic dissociationedmond louis antoine huot de goncourtyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (15)
breach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nationsbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadetransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing