Words Containing: A,C,E,E,N,R,R
(In Any Order)
There are 882 words,
2,935 phrases and
0 abbr's with
A,C,E,E,N,R,R in.
Best Scoring Words With: A,C,E,E,N,R,R
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| rebranched | 10 | 18 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| abhorrence | 10 | 17 | nounn | |||||
noun • hate coupled with disgust | ||||||||
| encroacher | 10 | 17 | nounn | |||||
noun • someone who enters by force in order to conquer | ||||||||
| rebranches | 10 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| mercenary | 9 | 16 | nounn | |||||
noun • a person hired to fight for another country than their own adjective satellite • marked by materialism • serving for wages in a foreign army • profit oriented | ||||||||
| reprobance | 10 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| regeneracy | 10 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| precancers | 10 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| carragheen | 10 | 16 | nounn | |||||
noun • dark purple edible seaweed of the Atlantic coasts of Europe and North America | ||||||||
| coparcener | 10 | 16 | nounn | |||||
noun • Any of several people who share an inheritance; a parcener. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (27)
carpentermercenaryrecreanceaberrancecrenatureincreaserlarcenerscareenersrecanterscareeringprecancererranciesinterracecertainerparcenerscentralerreenactorcarbineercarrageennoncareerrecreancyrecreantsunclearercerbereancerberianrancheriecalendrerPhrases (4)
career mancrape fernnegro racegreen cardWords (46)
recreationfreelancerencouragerabhorrenceencroacheradrenergicreprobancecarpentersregeneracyaberrancesprecancersrebranchedunderreactropedancercarbineerscarrageenscarabineerincreaserscarragheenrebranchescrenaturesreenactorscoparcenerrecreancesrecreatingcalendererreentrancecaravaneernecrolatereuro-trancemercenariaperdurancebarycenteruncerebralbarycentre
...View all with 10 letters...
Phrases (8)
air cleanertree branchdry cleanernerve tractregency eraamen cornercanker sorerace runnerWords (104)
performancemercenariesremembrancereassurancereincarnatecenterboardnecromancertransceiverbenchwarmerirrelevancyincarcerateforbearanceirrelevancecrapehangerrecriminatecrepehangerfurtherancecarabinierescaremongerrectilinearuncharteredcarrageeninarborescentcatercornercarpenteredcarpentriesunderreactsaberranciesprecreasingcarragheensabhorrencesconferrableresearchingcoparcenerscopartnered
...View all with 11 letters...
Phrases (28)
renal cortexurban centergarden cresspreacher manharness racedream trancecraig ventercrank letterscreen actorscreen saver
...View all with 11 letters...
Words (133)
perseveranceincarceratedrecreationaltransferenceredecoratingracketeeringredecorationmerchandiserrecuperationoverreactionreappearanceremembrancerunderchargedoverreachingcarpenteringrecessionaryprecancerousferricyaniderickenbackerhenceforwardprotuberancecarefreenessscenographerundersurfacetransparencetercentenaryremonstrancecontravenersscaremongersnecromancersunderreactedcerebrationsforbearancesarborescenceoverreliance
...View all with 12 letters...
Phrases (49)
grain cleanergarden rockethernan corteshernan cortezcentre spreadpassenger carprinter cablewestern larchcraig ventnerbreast cancer
...View all with 12 letters...
Words (142)
undercarriagethermonuclearconservatoireperpendicularoceanographerunderachieverrecalcitranceconcertmasterdecerebratingpreponderancerapprochementterpsichoreanintercellularunrecoverablecerebrospinalcorporatenessintracerebralrecriminativereinforceableencumbrancersunderreactingcounterchargetransferencesmercenarinessreconsecratedcamerapersonsarborescencesreaccreditingrecuperationsreactionariesremonstrancescorporealnessremanufactureprotuberancescounterplayer
...View all with 13 letters...
Phrases (101)
fire insurancerene descartesacrylate resincancer the crabgeneral francoclaude bernardrhea americanaeduard buchnercharge per unitimmune carrier
...View all with 13 letters...
Words (133)
contemporariesundersecretaryscatterbrainedcountermeasureirreconcilableendarterectomynonperformanceprecariousnessmercaptopurinecounterchargedcounterchargesreacceleratingbraunschweigerreconsecratingintercorporatereconsecrationintercorrelateoverdecoratingrapprochementsremanufacturedremanufacturesunderachieverspreponderancesarchdeaconriesresurrectionalcounterralliesconservatoriesthenceforwardsovercentralizerecommendatoryreincorporatedreincorporatescircularnessesultraenergeticrecalcitrances
...View all with 14 letters...
Phrases (127)
renal corpuscleemergency brakecanterbury belloriental cherrychinese rhubarbpartner in crimejapanese cherrycarpenter's rulescarlet tanagerradio frequency
...View all with 14 letters...
Words (91)
cinematographercounterargumentrecertificationreconcentrationreconsiderationcircumferentialperpendicularlyreproachfulnessultracentrifugetreacherousnessintercorrelatedintercorrelatesreaccreditationoverdecorationsmechanoreceptorpremanufacturedpremanufacturesenterobacteriumunchoreographedreorchestratingreorchestrationconfraternitiesinterperceptualsupercalenderedoverextractionsinterlacustrinemercurialnessesirrevocablenessantiforeclosurebraunschweigersreconsecrationsquatercentenaryconglomerateurscounterguerillacorynebacterial
...View all with 15 letters...
Phrases (170)
charlotte brontefalco peregrinusstrange particleconfederate rosegeorge vancouvercanterbury talescrepitation ralepersea americanacentral americaninsurance broker
...View all with 15 letters...
Words (58)
undersecretariescountersignatureinterventricularthermoremanencesreaccreditationsroentgenographiccreaturelinessesarchconservativerecentralizationrecertificationsperpendicularitycryopreservationrechoreographingreconcentrationscurvilinearitiesreconsiderationsprecariousnessesprecertificationtrichloromethanerectangularitiesxanthorrhoeaceaemerchant-venturerrefractivenessesrefractorinessesbeta-adrenoceptorsemitransparencyintercorrelatingmechanoreceptorsintercorrelationreorchestrationsintercrystallinesupercalenderingturbomachineriesultracentrifugedultracentrifuges
...View all with 16 letters...
Phrases (222)
czar alexander iiigenus crassostreanathaniel curriercovering materialtender loving careamerican sycamoregenus procellariarendering machinegreater celandinechristmas present
...View all with 16 letters...
Words (36)
countersignaturesirrevocablenessescounterstrategiescounterstrategistultraconservativecrashworthinesseschlortetracyclinearchconservativesrecentralizationsferrimagneticallycryopreservationsinsurrectionariesprecertificationstreacherousnessesdehydrochlorinasedehydrochlorinateintercorrelationsaerothermodynamicsuperconglomerateneuropsychiatriessuperconservativeelectroretinogramreproachfulnessescarnivorousnessesoverconcentrationcounteraggressionnitrobacteriaceaecountercommercialantiferromagneticirreplaceablenessnoncontemporariesoverorchestratingcounterguerrillasalpha-adrenoceptorirrecoverableness
...View all with 17 letters...
Phrases (271)
mary leontyne pricedirect correlationpontederia cordatalandscape gardenergenus ceratosaurusrepublic of armeniacatherine the greatcylinder separatorcorporate investorlacrimal secretion
...View all with 17 letters...
Words (33)
electrodynamometercounterstrategistsarchaeoastronomiescounterbombardmententerobacteriaceaeperpendicularitiescharacteristicnesscounterreformationdehydrochlorinasesdehydrochlorinateddehydrochlorinatesaerothermodynamicssuperconglomeratesultraconservativesovercentralizationelectroretinogramselectroretinographoverconcentrationscounteradvertisingcounteraggressionsorder-chenopodialesmicroenvironmentalnitrochloromethanechlortetracyclinestetrachlorethylenecounterdemonstratetetrachloromethanerecruiting-sergeanthyperconcentrationcorynebacteriaceaeirreconcilablenessirreproachablenesscounterretaliationPhrases (295)
erinaceus europaeusamerican revolutionlachrymal secretionmusculospiral nerverenaissance revivalread-only memory chipinterior decoratingsecond cranial nerveinterior decorationvictor frankenstein
...View all with 18 letters...
Words (30)
countertransferencecountersurveillanceresorcinolphthaleincounterdemonstratorgastroenterologicalmercury-contaminatedelectrodynamometersneuropharmacologiescontradictorinessesinterferometricallyultracontemporariesovercentralizationsovercommercializingelectroretinographselectroretinographycounteradvertisingsmicroelectronicallycounterconspiracieschlorofluoromethanehydroxytetracyclinetetrachloroethylenecounterdemonstratedcounterdemonstrateshyperconcentrationsirreconcilabilitiesirrecoverablenessesirreplaceablenessescounterreformationscounterretaliationsparadichlorobenzenePhrases (210)
favourable receptionerinaceus europeaeusrejoicing over the lawcease and desist ordersir noel pierce cowardpounds per square inchnancy freeman mitfordeuropean central bankheavier-than-air crafttheory of inheritance
...View all with 19 letters...
Words (17)
counterrevolutionaryelectroencephalogramparadichlorobenzenescountersurveillancescountertransferenceshyperadrenocorticismcounterdemonstrationadrenocorticosteroidanthropocentricitieselectroretinographicroentgenographicallychlorofluoromethanescounterdemonstratingcounterdemonstratorsnephroangiosclerosisirreconcilablenessesirreproachablenessesPhrases (219)
archeological remainslunar excursion modulepierre simon de laplaceambrose gwinett biercecommercial enterprisesphenisciform seabirdcommercial instrumentmercenaria mercenariaernst heinrich haeckelinsurance underwriter
...View all with 20 letters...
Words (11)
electroencephalographneuroendocrinologicalelectroencephalogramsadrenocorticosteroidsovercommercializationelectroretinographiesarenaria-melanocephalacountercountermeasurecounterdemonstrationsantiferromagneticallycounterinterpretationPhrases (181)
acrocentric chromosomesierra madre occidentalfrances hodgson burnettanthriscus cereifoliumconfederate rose mallowarchitectural ornamentketorolac tromethamineextrauterine pregnancyfield-effect transistorfrancisella tularensis
...View all with 21 letters...
Words (6)
counterrevolutionarieselectroencephalographselectroencephalographyovercommercializationscountercountermeasurescounterinterpretationsPhrases (186)
gregorian calendar monthprunus persica nectarinaschlumbergera truncatuscoronavirus disease 2019trazodone hydrochloridebarbara wertheim tuchmansir laurence kerr olivierherbert marshall mcluhanequal-area map projectionteacher-student relation
...View all with 22 letters...
Words (3)
electroencephalographicelectroencephalographerdichlorodifluoromethanePhrases (127)
parenthetical expressiongeorge macaulay trevelyanchlorpheniramine maleateapium graveolens rapaceumaristolochia serpentariaeuropean recovery programarticles of confederationrichard brinsley sheridantricyclic antidepressantsearch and destroy mission
...View all with 23 letters...
Words (3)
electroencephalographerselectroencephalographiesdichlorodifluoromethanesPhrases (125)
carnegie mellon universityargyroxiphium sandwicenseprivately held corporationcapture of fort ticonderogasir terence mervyn rattiganfrancois auguste rene rodincapital of northern irelandarthur meier schlesinger jr.radio detection and rangingrichard buckminster fuller
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (119)
united states secret servicecluster of differentiation 4balaenoptera acutorostratamary wollstonecraft shelleymiguel de cervantes saavedrafrancis scott key fitzgeraldtherapeutic rehabilitationfast local internet protocolboris leonidovich pasternakrudolf christian karl diesel
...View all with 25 letters...
Phrases (72)
charlotte anna perkins gilmanfrances eliza hodgson burnettconfederate states of americaright atrioventricular valvebrassica oleracea gongylodescorrectional rehabilitationwar of the austrian successionanton grigorevich rubinsteinadrenocorticotropic hormonesecretary of veterans affairs
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (60)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transducerdirector-stockholder relationfreedom from search and seizureco-operative republic of guyana
...View all with 27 letters...
Phrases (60)
interstate commerce commissionaleksandr feodorovich kerenskyoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemcapital of serbia and montenegrodemocratic republic of the congodepartment of homeland securitygrace ethel cecile rosalie allenmaster of arts in library science
...View all with 28 letters...
Phrases (54)
business interruption insurancealeksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organdisorganized type schizophreniacombination in restraint of tradesouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unit
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (25)
bachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisvicomte ferdinand marie de lessepsrepublic of bosnia and herzegovinamultiple correlation coefficientaugust friedrich leopold weismannwaterhouse-friderichsen syndromesevere acute respiratory syndromepolymonium caeruleum van-bruntiae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (37)
bureau of intelligence and research2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verditupac amaru revolutionary movementsir john frederick william herschelfrances elizabeth caroline willardrevolutionary proletarian nucleuschickasaw national recreation areaelectromotive drug administration
...View all with 31 letters...
Phrases (23)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagenikolai andreyevich rimsky-korsakov
...View all with 32 letters...
Phrases (21)
linear-quadratic-gaussian controllermusical instrument digital interfacebreach of trust with fraudulent intentlycopersicon esculentum cerasiformeobject-oriented programming languagebureau of alcohol tobacco and firearmspityrogramma calomelanos aureoflavaprivilege against self incriminationsir winston leonard spenser churchillright to speedy and public trial by jury
...View all with 33 letters...
Phrases (24)
jacques francois fromental elie halevyconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationnero claudius caesar drusus germanicusinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzeuropean law enforcement organisationvena centralis glandulae suprarenalis
...View all with 34 letters...
Phrases (14)
national technical information servicejohann christoph friedrich von schillertadeusz andrzej bonawentura kosciuszkocanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multipliernational socialist german workers' partyimmigration and naturalization servicetransurethral resection of the prostatefederal law enforcement training center
...View all with 35 letters...
Phrases (17)
center for disease control and preventionrank-difference correlation coefficientsecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarecriminal intelligence services of canada
...View all with 36 letters...
Phrases (15)
university of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdepartment of health education and welfare
...View all with 37 letters...
Phrases (10)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservenucleoside reverse transcriptase inhibitorfuerzas armadas revolucionarios de colombiaenzyme-linked-immunosorbent serologic assayPhrases (10)
minnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (6)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousness
