Words Containing: A,C,D,Y,E
(In Any Order)
There are 1,144 words,
1,893 phrases and
0 abbr's with
A,C,D,Y,E in.
Best Scoring Words With: A,C,D,Y,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| keycard | 7 | 17 | nounn | |||||
noun • a plastic card that has a magnetically coded strip that is scanned in order to operate a mechanism | ||||||||
| yachted | 7 | 16 | verbv | |||||
verb • To sail, voyage, or race in a yacht. | ||||||||
| yacked | 6 | 16 | verbv | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
| academy | 7 | 15 | nounn | |||||
noun • a secondary school (usually private) • an institution for the advancement of art or science or literature • a school for special training • a learned establishment for the advancement of knowledge | ||||||||
| mediacy | 7 | 15 | nounn | |||||
noun • the quality of being mediate | ||||||||
| cadency | 7 | 15 | nounn | |||||
noun • a recurrent rhythmical series | ||||||||
| decayed | 7 | 14 | verb, adjectivev, adj | |||||
adjective satellite • damaged by decay; hence unsound and useless | ||||||||
| cyanide | 7 | 13 | nounn | |||||
noun • any of a class of organic compounds containing the cyano radical -CN • an extremely poisonous salt of hydrocyanic acid | ||||||||
| daycare | 7 | 13 | nounn | |||||
noun • childcare during the day while parents work | ||||||||
| ardency | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
decayWords (44)
delicacyheadachycycladesadequacyverdancydelegacycopyreadcyanidescayenneddecayingacylateddecenaryfederacyecdysialcrayonedkeycardslackeyedendarchydaycarescyanidedalcaydescyanosedcheddarydecayerscarboyedsacredlydeaconrydeviancydiacetyladenyliccydippeachelydracalycleddecumarycyanised
...View all with 8 letters...
Phrases (7)
dry cleaneye candytea caddycd playercandy eggbasic dyead agencyWords (79)
democracysecondarysyndicatemedicallyayurvedicpachydermimmediacychandleryhackneyedmendacitycomraderycomradelycatalyzedclepsydradecayabledecennaryadjacencyadipocytewheyfacedundecayedskyjackededucatorydeacidifycrabbedlyplayactedheadacheydecimallydecadencylacqueyeddecalcifyedictallyecdysiastpredacitycrazyweeddecayless
...View all with 9 letters...
Phrases (10)
ready cashhue and crycase studyspeech daydry cerealbeta decaynose candyrice paddycrazy weedcandy caneWords (125)
incendiarydelicatelyredundancydebaucherysyndicatedinadequacyascendancycardplayerdegeneracysyncopatedcopycattedaffectedlycyclopediaclydesdaledeclassifydespicablyindelicacyascendencychalcedonymendicancycopyreaderadvertencyclepsydrasacrylamideadipocytesimmoderacyadjacentlydetachablyaccursedlyayurvedicsbellyachedpachydermsdelectablydecadentlyclepsydrae
...View all with 10 letters...
Phrases (31)
alpha decaycarded yarnconan doyled'oyly carteoxygen aciddry cleanercathode raycanary seedcancer bodybinary code
...View all with 10 letters...
Words (146)
documentarydiscrepancypterodactylconfederacyaerodynamicpredictablyvaledictoryschenectadypsychedeliamelodicallyidenticallycommendablyhemodynamicanecdotallysecondarilycomedicallytragicomedymedicinallydeclaratorydeprecatorybarefacedlyphyllocladecyclopaediacyclopediasveridicallycordwainerypiggybackededucabilityhedonicallyeideticallycopyreadingdeterminacydedicatedlydialectallyacrylamides
...View all with 11 letters...
Phrases (38)
dry cleaningbald cypressboulder claycaraway seeddisplay casecome in handymeadow clarygandy danceracetone bodycalendar day
...View all with 11 letters...
Words (182)
accidentallyincidentallyconsiderablyencyclopediaperiodicallyaerodynamicscrystallizedacademicallydomesticallymethodicallyappendectomycarbohydratehyperacidityindelicatelycardiomegalycalculatedlyinadvertencycommendatoryferricyanidecrystallisedpedanticallydepreciatoryabstractedlyhydrocephalymendaciouslydenunciatoryantecedentlycondemnatoryphagocytosedhypothecatedshamefacedlydecasyllabledistractedlydeacidifyingcadaverously
...View all with 12 letters...
Phrases (57)
ascension daygenus cydoniadevil-may-careacid hydrogengrand larcenycare deliverybreach of dutyrichard e. byrdcyanide groupcandy striper
...View all with 12 letters...
Words (167)
ideologicallydiscretionaryencyclopaediahydrocephalusadrenalectomyeducationallythermodynamicdiametricallyindescribablydisgracefullyindeterminacyendolymphaticconsideratelyhydrocephalicencyclopaedicunpredictablycreditabilityclandestinelyradioactivelydiscreditablypedagogicallybasidiomycetedelectabilityencyclopediasprejudiciallyaerodynamicaldeprecatinglydeprecatorilydetachabilitydyspepticallydeclassifyingdetectabilitycomplicatedlyaperiodicallyclearheadedly
...View all with 13 letters...
Phrases (78)
direct antonymsecond balconyfamily picidaecustody battlesystem commandbody substanceclyde tombaughcedar mahoganydata hierarchycretan dittany
...View all with 13 letters...
Words (141)
coincidentallydemocraticallyundersecretaryconfidentiallythermodynamicspredictabilityappendicectomyinconsiderablyidealisticallyhydropneumaticendarterectomyorthopedicallydirectionalitydisconsolatelyconsuetudinarycyproheptadinepachydermatouspsychoanalyzedmalcontentedlyhedonisticallyelectrodynamicrecommendatoryidiosyncrasiesconcentratedlyincandescentlyimmethodicallyrecrystallizedadrenergicallypolyacrylamideencyclopaediashydromechanicsdolichocephalyaerodynamicistacknowledgedlyclairaudiently
...View all with 14 letters...
Phrases (118)
order mysidaceapolymeric amidedata encryptiondynamic balancedynamic speakermass deficiencyradio frequencyhenry cavendishanser cygnoidescrime syndicate
...View all with 14 letters...
Words (112)
confidentialityaerodynamicallydemographicallyinconsideratelyperpendicularlybidirectionallysemidocumentarydemystificationpsychedelicallyhydromechanicalpolysaccharidesdisenchantinglycyproheptadinessophisticatedlyradiometricallysemicylindricalcoeducationallypolyacrylamidesreduplicativelysynecdochicallyaerodynamicistsdecarboxylationhypochondriasesdecarboxylatingunanticipatedlydermatoglyphicsglyceraldehydesineradicabilityhemodynamicallyideographicallythermodynamicalplatinocyanidesradiochemicallyelectrodialyseselectrodialysis
...View all with 15 letters...
Phrases (162)
auditory ossiclecharlotte cordayclass pelecypodadialysis machineadvisory servicefamily astacidaecomplex body partamebic dysenterymacleaya cordataindependence day
...View all with 15 letters...
Words (39)
indiscriminatelyunpredictabilityperpendicularitycyclophosphamidehydrocharidaceaehydrocharitaceaedecarboxylationsdodecaphonicallyechocardiographyindescribabilityelectrohydraulicdemystificationscarboxypeptidasehendecasyllabicshendecasyllablescardiomyopathiesundemocraticallycryptobranchidaeancylostomatidaeencyclopedicallypseudoparenchymahomoscedasticitytranscendentallydiacetylmorphinesympathectomizednondiscretionarycalcium-cyanamidedihydroxyacetonemelodramaticallycladogeneticallythelypteridaceaemethodologicallysedative-hypnoticpaedogeneticallyquasiperiodicity
...View all with 16 letters...
Phrases (171)
family cyprinidaecardiac glycosidefamily locustidaedeed of conveyancegrand canyon statefamily buccinidaeaerodynamic forcefamily formicidaeglyceric aldehydefamily carangidae
...View all with 16 letters...
Words (31)
parathyroidectomycardiorespiratorythermodynamicallyinterdisciplinaryself-contradictorycercidiphyllaceaekaleidoscopicallydisrespectabilitycyclophosphamidesdehydrochlorinasesamoyedic-speakingdehydrochlorinateptilonorhynchidaeaerothermodynamicturbidimetricallydesynchronisationdesynchronizationcarboxypeptidasesdeoxyribonucleaseornithorhynchidaephotoperiodicallypseudoparenchymasdeterministicallyepidemiologicallyhydroelectricallydialectologicallyeleutherodactylusdihydroxyacetoneshaemorrhoidectomythermodynamicistspolycondensationsPhrases (176)
mary mcleod bethuneclass rhodophyceaecylinder separatorfamily trochilidaecaesarian deliveryfamily droseraceaehexadecimal systemafrican yellowwoodfamily erinaceidaeindependent agency
...View all with 17 letters...
Words (15)
electrodynamometercylindrical-stemmedlipopolysaccharidemucopolysaccharidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesaerothermodynamicsdeoxyribonucleaseshomobasidiomycetespseudoparenchymatahydrometallurgicalsedimentologicallychlamydomonadaceaediethylcarbamazinePhrases (167)
bombycilla cedrorunfreudian psychologyread-only memory chipfamily trichechidaefamily desmidiaceaemegacycle per secondsolid body substancevictory in europe dayapodemus sylvaticusphoenix dactylifera
...View all with 18 letters...
Words (19)
hydrochlorothiazideparathyroidectomiesmucopolysaccharideslipopolysaccharidescytodifferentiationmagnetohydrodynamicphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedelectrodynamometerscontradistinctivelyencephalomyelitideshydroxytetracyclinehydrometeorologicaldiethylcarbamazineshypoadrenocorticismelectrocardiographyPhrases (173)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaehydrastis canadensisfamily dasyproctidaenancy freeman mitfordfamily polypodiaceaehydrobates pelagicusdasypus novemcinctusliquid body substance
...View all with 19 letters...
Words (13)
tetrahydrocannabinolparathyroidectomizedhyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesmagnetohydrodynamicsencephalomyocarditispseudoparenchymatoushydrochlorothiazidesheterobasidiomycetesPhrases (159)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedivision tracheophytaclyde william tombaughfamily dermochelyidaesuricata tetradactylafamily pseudococcidaelophodytes cucullatus
...View all with 20 letters...
Words (3)
phosphoglyceraldehydedendrochronologicallytetrahydrocannabinolsPhrases (97)
icelandic monetary unitdesoxyribonucleic acideucalyptus fraxinoidescambodian monetary unitprocaine hydrochloridehenry hobson richardsonsamuel taylor coleridgefamily myrmecophagidaefederal security bureaucape verde monetary unit
...View all with 21 letters...
Words (2)
phosphoglyceraldehydesencephalomyocarditisesPhrases (94)
trazodone hydrochloridefamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianmale reproductive systembrachycome iberidifoliafamily branchiostomidaecombined dna index systemedna saint vincent millayparliamentary procedure
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (56)
argyroxiphium sandwicensesubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwinprivately held corporationapocynum androsaemifoliumantiarrhythmic medicationtechnology administrationfederal republic of germanysir charles leonard woolley
...View all with 24 letters...
Phrases (43)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldpolystichum acrostichoidescaulophyllum thalictroidesandrei arsenevich tarkovskylepidocybium flavobrunneumreticuloendothelial systemnational academy of sciencesdevelopmentally challengedsystematic desensitisation
...View all with 25 letters...
Phrases (38)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency viruscharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinasubdivision deuteromycotinabureau of diplomatic securityentandrophragma cylindricumconjunctival layer of eyelids
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (27)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (19)
aleksandr feodorovich kerenskyoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemhydrangea macrophylla hortensisfrancisco jose de goya y lucientestheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (14)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidwaterhouse-friderichsen syndromesevere acute respiratory syndromemucocutaneous lymph node syndromenontricyclic antidepressant drugtechnical analysis of stock trendsbasic point defense missile system
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
digital communications technology2019-ncov acute respiratory diseaserecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasdefense information systems agencymary godwin wollstonecraft shelleyPhrases (11)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatetheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensisfederal emergency management agencyamaranthus hybridus erythrostachys
...View all with 32 letters...
Phrases (8)
severe combined immunodeficiency diseaseattention deficit hyperactivity disordergenerally accepted accounting principlessecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
