Words Containing: A,A,M,S,Y
(In Any Order)
There are 794 words,
1,747 phrases and
0 abbr's with
A,A,M,S,Y in.
Best Scoring Words With: A,A,M,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pyjamas | 7 | 21 | nounn | |||||
noun • a pair of loose trousers tied by a drawstring around the waist; worn by men and women in some Asian countries • (usually plural) loose-fitting nightclothes worn for sleeping or lounging; have a jacket top and trousers | ||||||||
yashmak | 7 | 19 | nounn | |||||
noun • the face veil worn by Muslim women | ||||||||
yashmac | 7 | 17 | nounn | |||||
noun • the face veil worn by Muslim women | ||||||||
maydays | 7 | 16 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
yasmaks | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
yasmak | 6 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
abysmal | 7 | 14 | adjectiveadj | |||||
adjective satellite • very great; limitless • resembling an abyss in depth; so deep as to be unmeasurable | ||||||||
caymans | 7 | 14 | nounn | |||||
noun • a semiaquatic reptile of Central and South America that resembles an alligator but has a more heavily armored belly | ||||||||
bayamos | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
daysman | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
mayasWords (32)
malaysialamaserymainstaysyntagmamyalgiasamylasesyamalkasyashmaksgymnasiashamablydaymarespalmyrasamboynasseamanlyyamulkasmisassaytramwaysyardarmspyaemiasatemoyasyashmacsmamaguysmanyatasanonymasjambiyasdaymarksamygdalssealyhamparanymsmisarrayplatysmawaymarksPhrases (6)
swamp bayalms trayeasy markarmy basejames baymama's boyWords (67)
himalayascataclysmmalaysianamaryllisyachtsmanpaymastermanslayerabysmallyhamadryasplaymatesdaydreamsamygdalesanisogamymainstaysroyalmastarythmiassyntagmasmangabeysgraymailsgymkhanasmaccaboysgymnasialcarbamylsmaryjanesgramaryesmalarkeyscyanamidssciamachyshameablysalarymansalarymensafetymanashamedlyhogmanaysnamaycush
...View all with 9 letters...
Phrases (5)
lammas daymealy sagemamma's boylady's maidroyal mastWords (86)
mayonnaiseyardmasterparoxysmalmycoplasmameasurablymagistracymyastheniaaneurysmalkanamycinshamadryadsmanslayerscataclysmslachrymalsdairymaidsplaymakerspaymastersplasmogamycycloramascarbamoylsjambalayascyanamidesmyrobalansmosaicallycandygramsamygdalinsamblyopiasparamylumsamyloplastmetastablyamyotoniashypomaniasroyalmastsparanymphsmisassayedcyclamates
...View all with 10 letters...
Phrases (16)
moshe dayanthomas grayby all meansstay-at-homesea lampreymary stuartyerba mansasun-ray lampdata systempalm sunday
...View all with 10 letters...
Words (93)
cataclysmicassemblymanunashamedlypsychodramaimmunoassaymasticatorycataclysmalanomalouslydaydreamersmisanalysisflamboyantsmagistrallyparenchymaskaryogamiesyardmastersmayonnaisespyromaniacsplaymakingsacrylamidesagamospermyshaggymanesaerenchymasamarylliseshypermaniasastrocytomametanalysesmetanalysishyaloplasmsmyastheniasamygdaloidsautosomallysomaticallyamyloplastsmisanalysesambrosially
...View all with 11 letters...
Phrases (23)
grass familyshy away fromdylan thomasthomas hardysumac familyjames murrayaster familybrass familycyma reversaalarm system
...View all with 11 letters...
Words (112)
metaphysicalaerodynamicshypothalamusasymmetricalimmeasurablymasturbatoryunmistakablymajesticallysubmaxillarycalamitouslyasymptomaticsemiannuallymicroanalystshamefacedlyflamboyancessemanticallymonasticallyamateurishlytetrahymenasgynecomastiasimoniacallyapocalyptismastrocytomaspsychodramasrampageouslyimmunoassaystestamentaryhypokalemiasassimilatorymycoplasmataassumabilitychamaephytesmythomaniacssynaptosomalnymphomanias
...View all with 12 letters...
Phrases (44)
christmas daymass hysteriaeast malaysiastorax familya. noam chomskystyrax familyways and meansarmistice dayharry s. trumansafety margin
...View all with 12 letters...
Words (110)
magisteriallyspasmodicallymagnanimouslyembarrassedlylymphosarcomaimpassabilitysaccharomycesbombasticallymeasurabilityholidaymakerssacramentallygymnasticallyimagisticallymicroanalysesmicroanalysismicroanalystshypocalcemiasatomisticallyassemblywomancomplaisantlyprismaticallyflamboyanciesonomasticallyscalariformlyapocalyptismsastrocytomatagynecomastiasstigmaticallysympatricallyfibromyalgiasmetaphysicianambisexualitymecamylaminespharmacognosyparamyxovirus
...View all with 13 letters...
Phrases (52)
aleatory musicin a similar waycooley's anemiashammy leathergenus martyniagenus nymphaeadna polymerasestrawberry jamorphans' asylumpsychic trauma
...View all with 13 letters...
Words (84)
systematicallyembarrassinglymetaphysicallyastronomicallyasymmetricallypachydermatousaxisymmetricalmoralisticallymetaphysiciansassimilabilityparenchymatoushumanisticallynaphthylaminesmartyrizationsapocalypticismorganismicallyaerodynamicistlymphosarcomaspsychodramaticreactionaryismasymptoticallymetastaticallyhypomagnesemiamegakaryocyteshypercalcemiasaposematicallymegascopicallytransmigratorycampylobacterstalismanicallyschismaticallynumismaticallyastigmaticallysacramentalitythymelaeaceous
...View all with 14 letters...
Phrases (103)
order mysidaceamyrrhis odorataadmiralty brassmaxillary sinusbusman's holidaycooley's anaemiadrainage systemcynara scolymusfamily vespidaecombat casualty
...View all with 14 letters...
Words (82)
compassionatelygastronomicallysympatheticallysystematizationsymptomaticallycyanocobalaminsankylostomiasesankylostomiasissaccharomycetestrypanosomiasisancylostomiasesancylostomiasispolyacrylamidesatmosphericallyapocalypticismslymphangiogramsmechanisticallyaerodynamicistsmasochisticallyhyperparasitismlymphosarcomatareactionaryismsintramuscularlyimmunoassayablemeroblasticallyparamyxovirusesmacrocosmicallymacroscopicallyhypomagnesemiasmagistraticallyhypercatabolismparasympathetictrypanosomiasescataclysmicallymartensitically
...View all with 15 letters...
Phrases (136)
alimentary pasteasamiya languagedialysis machinejohn quincy adamsadmiralty islandfamily astacidaeradial asymmetrylouisa may alcottjemaah islamiyahmask of pregnancy
...View all with 15 letters...
Words (36)
circumstantiallymonosyllabicallythermostaticallyrhabdomyosarcomaadministrativelyparasympatheticsmalayo-polynesianarchaeoastronomymonosynapticallycyanocobalaminesasymptomaticallylymphogranulomaslymphangiectasialymphangiectasispharmacodynamicssyncategorematicsemitransparencymegagametophytesmycoplasmataceaemeristematicallyunsystematicallyphyllostomatidaecardiomyopathiesradioimmunoassayancylostomatidaepseudoparenchymasuprarenalectomyhypercatabolismssystematizationstachyarrhythmiasantimetaphysicalmilitaristicallymisanthropicallyhyperparasitismstetramethylleads
...View all with 16 letters...
Phrases (136)
in a beastly mannerchemical analysisamerican sycamorepodocarpus familyfamily locustidaesubfamily bovinaeofficial emissarymechanical systemexemplary damagescalystegia sepium
...View all with 16 letters...
Words (19)
materialisticallyparaformaldehydesradioimmunoassayslymphadenopathiesbathythermographssamoyedic-speakingglycosaminoglycanimperialisticallyunsympatheticallyimprovisationallymetapsychologicalrhabdomyosarcomaspseudoparenchymaspsychodynamicallysemiautomaticallystreptomycetaceaesymptomatologicalpsychosomaticallycircumstantialityPhrases (138)
balaena mysticetusfamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusmalaysian languagecalycanthus familycapital of malaysiafamily droseraceaesubfamily loriinae
...View all with 17 letters...
Words (15)
psychopharmacologyhypoparathyroidismlymphangiographiestransformationallypteridospermaphytamucopolysaccharidesaccharomycetaceaeglycosaminoglycansaerothermodynamicsmethylnaphthalenesrhabdomyosarcomatapseudoparenchymatahyperalimentationssemiquantitativelysomnambulisticallyPhrases (173)
bombycilla garrulusadministrative bodyfamily physeteridaelachrymal secretionnavigational systemmary wollstonecraftfamily asparagaceaefamily desmidiaceaegenus chamaecytisusambystoma mexicanum
...View all with 18 letters...
Words (13)
hyperparathyroidismparathyroidectomieshypoparathyroidismsmucopolysaccharidesphenomenalisticallyhysterosalpingogramparasympathomimeticpsychopharmacologicsymptomatologicallydiethylcarbamazinestetramethyldiarsineschizosaccharomycespolychromatophiliasPhrases (168)
family cynoglossidaefamily lepisosteidaezairese monetary unitfamily dasyproctidaesubfamily mephitinaesubfamily perdicidaesubfamily potoroinaeedna st. vincent millayspanish monetary unitgerard manley hopkins
...View all with 19 letters...
Words (15)
radioimmunoassayablelymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesmagnetohydrodynamicsultramicroscopicallyencephalomyocarditispseudoparenchymatouspsychopharmacologiespsychopharmacologistsyncategorematicallyplethysmographicallyhyperparathyroidismsPhrases (162)
william stanley jevonswyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesmechanically skillfulfamily pseudococcidaeambystomid salamanderclassification systemsouth american country
...View all with 20 letters...
Words (3)
psychopharmacologicalmucopolysaccharidosispsychopharmacologistsPhrases (116)
nikolai rimsky-korsakovmalaysian monetary unithelichrysum bracteatumsri lankan monetary unitginglymostoma cirratumcucurbita argyrospermastrawberry haemangiomasamuel taylor coleridgeagricultural chemistrypakistani monetary unit
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (91)
subfamily bassariscidaerhythm and blues musiciansurinamese monetary unitfamily branchiostomidaeindonesian monetary unitedna saint vincent millayamygdalus communis amaravietnamese monetary unitsamuel pierpoint langleychrysanthemum balsamita
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (76)
family threskiornithidaekazakhstani monetary unitkyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unittajikistani monetary unitgroup pteridospermaphytasearch and destroy missionuzbekistani monetary uniteastern malayo-polynesian
...View all with 23 letters...
Words (2)
phosphatidylethanolamineschizosaccharomycetaceaePhrases (64)
louis seymour bazett leakeyargyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley masontechnology administration
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (48)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversarysymphoricarpos orbiculatusmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemwestern samoan monetary unit
...View all with 25 letters...
Phrases (34)
submandibular salivary glandassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision basidiomycotinasubdivision mastigomycotinabureau of diplomatic securitysystem of weights and measuresmyrtillocactus geometrizanscalycophyllum candidissimumscardinius erythrophthalmus
...View all with 26 letters...
Phrases (31)
business environment analysisnuclear regulatory commissiondeoxyadenosine monophosphatesecretary of commerce and laborjames augustine aloysius joycefalkland islands monetary unithydraulic transmission systemmikhail sergeyevich gorbachevsysteme international d'unitesprimary sexual characteristic
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (24)
cardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguesmall computer system interfacecygnus columbianus columbianusimperial japanese morning glorynonsteroidal anti-inflammatoryhypothalamic releasing hormone
...View all with 28 letters...
Phrases (13)
business environmental analysisautomatic data processing systemsao thome e principe monetary unitmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonanonymous file transfer protocoldecimal system of classificationmaturity-onset diabetes mellitusenvironmental business analysis
...View all with 29 letters...
Phrases (10)
balance of international paymentssevere acute respiratory syndromecalymmatobacterium granulomatishenri rene albert guy de maupassant1st viscount montgomery of alameinpositional representation systemfamily schizosaccharomycetaceaeprovisional irish republican armydisseminated lupus erythematosusdame agatha mary clarissa christiePhrases (12)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlenikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugprimary subtractive colour for lightoculopharyngeal muscular dystrophybosnian-herzegovinian monetary unitchrysanthemum coronarium spatiosum
...View all with 32 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memorygymnosporangium juniperi-virginianaecomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratoryunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay