Words Containing: A,A,M,R,Y
(In Any Order)
There are 1,017 words,
2,553 phrases and
0 abbr's with
A,A,M,R,Y in.
Best Scoring Words With: A,A,M,R,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
mammary | 7 | 16 | noun, adjectiven, adj | |||||
adjective • of or relating to the milk-giving gland of the female | ||||||||
malarky | 7 | 16 | nounn | |||||
noun • empty rhetoric or insincere or exaggerated talk | ||||||||
tramway | 7 | 15 | nounn | |||||
noun • a conveyance that transports passengers or freight in carriers suspended from cables and supported by a series of towers • the track on which trams or streetcars run | ||||||||
palmyra | 7 | 14 | nounn | |||||
noun • tall fan palm of Africa and India and Malaysia yielding a hard wood and sweet sap that is a source of palm wine and sugar; leaves used for thatching and weaving | ||||||||
dramady | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
palmary | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
yardman | 7 | 13 | nounn | |||||
noun • worker in a railway yard • a laborer hired to do outdoor work (such as mowing lawns) | ||||||||
yardarm | 7 | 13 | nounn | |||||
noun • either end of the yard of a square-rigged ship | ||||||||
gramary | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
ambary | 6 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (36)
pharmacymarylanddaydreammalarkeylamaseryramayanafarmyardyarmulkachambraydairymanhaymakercalamaryamorallyarythmiagraymailcarbamylmaryjanegramaryedaymaresrampancypalmyrastramwaysyardarmslaminarymartyrialacrymalmaitreyababygramdaymarksparanymsmainyardmisarraymartyniayarramanyarramen
...View all with 8 letters...
Phrases (12)
mary janealms trayeasy markarmy basehail marymain yardparty manmanta raygamma rayarmy brat
...View all with 8 letters...
Words (91)
imaginarymandatoryadmiraltypyramidalamaryllisadmirablyplaymakerpaymastermanslayermayoraltypantrymanhamadryaslachrymalpyromaniamaxillaryamoralityquarrymandamnatoryampullarydairymaidcycloramamaritallydaydreamsdaydreamtdaydreamyroyalmastarythmiaskaryogamykerygmatamacabrelymyrobalangraymailscarbamoylcarbamylsmaryjanes
...View all with 9 letters...
Phrases (10)
man fridayprayer matmarket daycyma rectaparty gamemargay catkaraya gumdairy farmroyal mastroyal palmWords (111)
remarkablypyromaniacabnormallyarrhythmiayardmastermateriallymyocardialdaydreameralarminglydramaturgymarginallyfamiliarlycavalrymanparoxysmalalimentarylaundrymanambulatorymatriarchydefamatorymammillarymeasurablymagistracylaparotomyrailwaymanmaternallyaneurysmalmonaurallymalapertlyacrylamidedaydreamedamendatoryhamadryadscomparablymanslayersparenchyma
...View all with 10 letters...
Phrases (20)
mary leakeyyard markergray marketgray matterthomas grayarum familymary mallonmary martinsea lampreymary stuart
...View all with 10 letters...
Words (121)
daydreamingfamiliarityabnormalityaerodynamicmaterialityfragmentaryinfantrymanpsychodramaexclamatorymasticatoryimpartiallylachrymatorgallimaufrymandatorilymanufactorypyramidicaldaydreamersfilamentarymagistrallyparenchymaskaryogamiesyardmasterspyromaniacsmaladroitlyacrylamidesimaginarilyagamospermyaerenchymasamaryllisesmammographyaromaticityhypermaniasalkalimetrymalariologypyramidally
...View all with 11 letters...
Phrases (53)
grass familyadmiral byrdshy away frommemorial daybilly grahammathew bradymelange yarnmilitary manmeadow clarythomas hardy
...View all with 11 letters...
Words (139)
dramaticallyromanticallyparamilitaryinflammatoryaerodynamicsasymmetricalaromatherapypharmacologyimpartialityimmeasurablyartillerymanmasturbatoryhyperkalemiaincomparablysubmaxillaryhyponatremiacardiomegalylaundrywomanantimilitarymethacrylateharmonicallytraumatologyadmirabilityamelioratoryholidaymakerextramurallymicroanalystmanageriallyornamentallyparanormallyintracompanyintramurallyamateurishlytetrahymenasunfamiliarly
...View all with 12 letters...
Phrases (71)
mary magdalenmary mccarthyadmiral deweyadmiralty lawmaterial bodychristmas daydevil-may-caredramatic playmathew b. bradymass hysteria
...View all with 12 letters...
Words (128)
approximatelyparliamentarycomparativelygrammaticallymarketabilityaffirmativelyhypercalcemiaadrenalectomydiametricallymagisteriallyunfamiliarityembarrassedlylymphosarcomapragmaticallysaccharomycescomparabilitymeasurabilityholidaymakerssacramentallymartyrizationmicroanalysesmicroanalysismicroanalystsaerodynamicaladumbrativelychromaticallyprismaticallyparanormalityformulaicallyfragmentarilycampylobacterirreclaimablymatrimoniallyperambulatorypanoramically
...View all with 13 letters...
Phrases (95)
aleatory musicfamily laridaemyrobalan plumin a similar waycardiac rhythmadmiralty milecedar mahoganypraying mantidshammy leathergenus martynia
...View all with 13 letters...
Words (106)
cinematographymetaphoricallydemocraticallycardiomyopathypancreatectomyembarrassinglyastronomicallyimpracticalitydepartmentallychromatographyasymmetricallypachydermatousaxisymmetricalarithmeticallymoralisticallyparametricallyparenchymatoushydrodynamicalachromaticallyantidromicallymultilaterallypolyacrylamidemartyrizationsextrapyramidalmegakaryocyticorganismicallylymphangiogramaerodynamicistgrammaticalitycyanobacteriumlymphosarcomaspsychodramaticunromanticallyreactionaryismantiarrhythmic
...View all with 14 letters...
Phrases (151)
pearl mae baileylachrymal glandorder mysidaceafamily ardeidaemyrrhis odorataadmiralty brassnavy departmentmaxillary sinusadmiralty metalmodal auxiliary
...View all with 14 letters...
Words (108)
aerodynamicallymaneuverabilitycardiopulmonaryunparliamentarydramaturgicallylogarithmicallygastronomicallydemographicallytemperamentallymicroanalyticalalgorithmicallyhydromechanicalmerchantabilitymarriageabilityincomparabilitysaccharomycetesradiometricallygravimetricallytrypanosomiasistetramethylleadinformationallypolyacrylamidesnecromanticallymetallurgicallyatmosphericallycombinatoriallymetamorphicallylymphangiogramsaerodynamicistsprogrammabilitylymphogranulomahyperparasitismtachyarrhythmiadithyrambicallylymphosarcomata
...View all with 15 letters...
Phrases (216)
alimentary pastefamily arecaceaefamily leporidaefamily artamidaeadmiralty islanddiamond jim bradyfamily triglidaeradial asymmetrybroomrape familymaternal quality
...View all with 15 letters...
Words (51)
circumstantiallypharmaceuticallythermostaticallyrhabdomyosarcomaparadigmaticallyparaformaldehydeparamagneticallyadministrativelyparasympatheticsarchaeoastronomyrechromatographylymphogranulomasmultifactoriallymacrophotographylymphangiographypharmacodynamicsbathythermographanti-inflammatorysyncategorematicphonogrammicallysemitransparencymyxobacteriaceaemycobacteriaceaehyperlipoidaemiameristematicallyalphanumericallycalorimetricallyanagrammaticallycardiomyopathiesprogrammaticallyundemocraticallyradioimmunoassayimpracticabilitynoncomparabilitymicrographically
...View all with 16 letters...
Phrases (218)
tympanic membranein a beastly mannerfamily cyperaceaefamily cyprinidaeamerican sycamorepodocarpus familycommercial agencyrelative majorityhome away from homeofficial emissary
...View all with 16 letters...
Words (30)
parathyroidectomymaterialisticallythermodynamicallyparaformaldehydesradioimmunoassaysmonochromaticallymammothermographyferrimagneticallyhyperalimentationlymphangiographiclymphogranulomatamacroevolutionarypharmacologicallybathythermographsimperialisticallyneuropharmacologyaerothermodynamicimprovisationallyultracontemporaryamphitheatricallyrhabdomyosarcomasbatrachomyomachiapseudoparenchymasdiaphragmaticallystreptomycetaceaephaeochromocytomacircumstantialitypyrometallurgicallogogrammaticallythermographicallyPhrases (237)
dame margot fonteyncuban monetary unitlycopus americanussubphylum craniatafamily trochilidaecapital of marylandmountain cranberryfamily droseraceaesubfamily loriinaesubfamily lutrinae
...View all with 17 letters...
Words (19)
psychopharmacologyhypoparathyroidismlymphangiographiestransformationallycalymmatobacteriumpteridospermaphytadiethylmalonylureamucopolysaccharidesaccharomycetaceaepheochromocytomataaerothermodynamicsmetallographicallyrhabdomyosarcomatacryptogrammataceaepseudoparenchymatahydrometallurgicaldiethylcarbamazinehyperalimentationspolychromatophiliaPhrases (250)
bombycilla garrulusadministrative bodyfamily physeteridaelachrymal secretionafghan monetary unitmary wollstonecraftfamily trichechidaemetric capacity unitfamily asparagaceaecommercial activity
...View all with 18 letters...
Words (23)
hyperparathyroidismcinematographicallyparathyroidectomieshypoparathyroidismsmucopolysaccharidesmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidechromatographicallymercury-contaminatedinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropomorphicallycortico-hypothalamicphenylpropanolamineparasympathomimeticpsychopharmacologicdiethylcarbamazinestetramethyldiarsineschizosaccharomycespolychromatophiliasPhrases (244)
water-plantain familyfamily cyclopteridaeitalian monetary unitlatvian monetary unitphytolacca americanazairese monetary unitfamily dasyproctidaezambian monetary unitnancy freeman mitfordfamily tropaeolaceae
...View all with 19 letters...
Words (16)
radioimmunoassayableparathyroidectomizedlymphogranulomatoseslymphogranulomatosisphenylpropanolaminesphenylthiocarbamidesmagnetohydrodynamicsultramicroscopicallyencephalomyocarditischemotherapeuticallypseudoparenchymatouspsychopharmacologiespsychopharmacologistsyncategorematicallyplethysmographicallyhyperparathyroidismsPhrases (240)
honduran monetary unitorder mycelia steriliamalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaemarchantia polymorphafamily dermochelyidaebenjamin henry latrobeambystomid salamander
...View all with 20 letters...
Words (5)
psychopharmacologicalmucopolysaccharidosiselectromyographicallyantiferromagneticallypsychopharmacologistsPhrases (176)
icelandic monetary unitnikolai rimsky-korsakovmalaysian monetary unithelichrysum bracteatumbulgarian monetary unithungarian monetary unitsri lankan monetary unittanzanian monetary unitginglymostoma cirratumcambodian monetary unit
...View all with 21 letters...
Words (3)
pentamethylenetetrazolhexamethylenetetramineencephalomyocarditisesPhrases (118)
venezuelan monetary unithydrated aluminium oxidefamily dendrocolaptidaesubfamily bassariscidaeguatemalan monetary unitrhythm and blues musiciannicaraguan monetary unitsurinamese monetary unitparaguayan monetary unitbrachycome iberidifolia
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (103)
family threskiornithidaegeorge macaulay trevelyankazakhstani monetary uniteuropean recovery programkyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unittajikistani monetary unitgroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaschizosaccharomycetaceaePhrases (76)
louis seymour bazett leakeyargyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medicationalfred edward woodley mason
...View all with 24 letters...
Phrases (52)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversarysymphoricarpos orbiculatusmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemwestern samoan monetary unit
...View all with 25 letters...
Phrases (39)
submandibular salivary glandassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securitysystem of weights and measuresentandrophragma cylindricummyrtillocactus geometrizansscardinius erythrophthalmusintermediate temporal artery
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (33)
business environment analysisamerican revolutionary leaderorder of our lady of mount carmelnuclear regulatory commissionsecretary of commerce and laborfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission systemmikhail sergeyevich gorbachevsysteme international d'unites
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (28)
cardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leagueface-amount certificate companyrevolutionary proletarian armysmall computer system interfaceimperial japanese morning glorynonsteroidal anti-inflammatory
...View all with 28 letters...
Phrases (15)
business environmental analysisautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensispresident william henry harrisonanonymous file transfer protocolmaturity-onset diabetes mellitus
...View all with 29 letters...
Phrases (12)
ethylenediaminetetraacetic acidbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaecalymmatobacterium granulomatishenri rene albert guy de maupassant1st viscount montgomery of alameinpositional representation systemfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (11)
great smoky mountains national parktupac amaru revolutionary movementprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontmarine corps intelligence activityvladimir vladimirovich mayakovskidefense information systems agency
...View all with 31 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlenikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugprimary subtractive colour for lightoculopharyngeal muscular dystrophyfederal emergency management agencybosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (10)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavamercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicesinternational law enforcement agencycapital: critique of political economypositron emission tomography scanneridiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusPhrases (8)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and scienceserasable programmable read-only memorygymnosporangium juniperi-virginianaecomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
first epistle of paul the apostle to timothytrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratoryunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay