Words Containing: A,A,L,Y
(In Any Order)
There are 4,135 words,
4,844 phrases and
0 abbr's with
A,A,L,Y in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jaywalk | 7 | 24 | verb, adverbv, adv | |||||
verb • cross the road at a red light | ||||||||
| walkway | 7 | 20 | nounn | |||||
noun • a path set aside for walking | ||||||||
| halfway | 7 | 19 | adverb, nounadv, n | |||||
adverb • at half the distance; at the middle adjective satellite • equally distant from the extremes • at a point midway between two extremes • including only half or a portion | ||||||||
| analyze | 7 | 19 | verbv | |||||
verb • consider in detail and subject to an analysis in order to discover essential features or meaning • make a mathematical, chemical, or grammatical analysis of; break down into components or essential features • break down into components or essential features • subject to psychoanalytic treatment | ||||||||
| flyaway | 7 | 19 | adjectiveadj | |||||
adjective satellite • guided by whim and fancy • (of hair or clothing) worn loose | ||||||||
| taxably | 7 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
| affably | 7 | 18 | adverb, adjectiveadv, adj | |||||
adverb • in an affable manner | ||||||||
| galaxy | 6 | 17 | nounn | |||||
noun • a splendid assemblage (especially of famous people) • tufted evergreen perennial herb having spikes of tiny white flowers and glossy green round to heart-shaped leaves that become coppery to maroon or purplish in fall • (astronomy) a collection of star systems; any of the billions of systems each having many stars and nebulae and dust | ||||||||
| payably | 7 | 17 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| axially | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • with respect to an axis | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
alayWords (109)
alreadyhalfwayrailwayhallwayanalyzecavalryanalystanomalyanalyseanalogypayloadwallabycalgarypayablefatallywalkwaycalvaryfallacymalayanabysmalflyawaymayoralantalyawaylaidairplayhalyardpalmyracapablyaffablyabyssaljaywalkamiablylanyardmylantaplayact
...View all with 7 letters...
Phrases (11)
bay leafhay baleflag dayhardly amaya linlast daylady daybag ladyleap dayeasy lay
...View all with 7 letters...
Words (252)
actuallyanalysisbetrayalmalaysialandladyanalyzedcasualtycasuallyanyplacemanuallycalamitymarylandlavatoryplaybackcatalystannuallyfatalityalleywayplaymateparalyzeanalysedatypicalarguablymalarkeyrollawaysavagelyraciallyhimalayaamicablyamygdalalamaserycarryallanalyseranalyzerbanality
...View all with 8 letters...
Phrases (41)
natal dayfall awayaltar boybaby talkpay claimpull awaylock awayalms traybayt lahmsalt away
...View all with 8 letters...
Words (388)
basicallynaturallygraduallyparalyzedamazinglypartiallyanalyzingfairytalehimalayasparalysisauxiliarymagicallyplanetaryradicallyparalysedcataclysmadmiraltymalaysianactualityportrayalanalysinglafayetteawkwardlychlamydiablatantlyhimalayangallantrydastardlyayatollahpollyannaparalyticfavorablyanimalityvaliantlyfairyland
...View all with 9 letters...
Phrases (58)
salary cutmanila baylake nyasalaugh awayloya jirgafamily manalex haleyall the waylammas daywhile away
...View all with 9 letters...
Words (441)
apparentlylaboratoryseparatelyapocalypsevocabularyaccuratelyremarkablytragicallyyugoslaviareasonablycapabilitypleasantlyrationallybabylonianadequatelyinvariablyflamboyantabnormallymaniacallyabundantlyballplayeranalyticalnationallytyrannicalunbearablytacticallyarchetypalarrogantlyhabituallydiagonallymateriallyflagrantlymyocardialalarminglyparalysing
...View all with 10 letters...
Phrases (88)
canada lynxmary leakeyrailway carlead astraypalm familycall it a daylady godivadaily breadpoyang lakefrivol away
...View all with 10 letters...
Words (498)
practicallyfinanciallynationalitycalligraphyarchaeologydrasticallyclairvoyantfamiliaritycataclysmicabnormalityapocalypticassemblymanfranticallyarbitrarilyrationalityfashionablyexplanatorylaparoscopyorganicallyunspeakablyclassicallyerraticallymaterialityyugoslavianappallinglyretaliatoryunnaturallyangelicallysteadfastlyunavoidablypleasurablyelaboratelyalternatelyunabashedlyirreparably
...View all with 11 letters...
Phrases (149)
grass familylaying claimlaying wastebryonia albaadmiral byrdplaying areaoryx gazellaplayoff gameacrylic aciddwindle away
...View all with 11 letters...
Words (597)
particularlyaccidentallyoccasionallypennsylvaniadramaticallypassionatelymetaphysicalromanticallyartificiallyparamilitarytransylvaniainflammatorypatheticallyadditionallyavailabilityartisticallyanaphylacticmechanicallyhypothalamusasymmetricalanatomicallyacademicallyunilaterallyemphaticallypharmacologyclairvoyanceconstabularyinadequatelyunimaginablyadaptabilityimpartialitybreathalyzerunreasonablyimmeasurablyartilleryman
...View all with 12 letters...
Phrases (211)
mary magdalenvisual acuityscantily cladcalvary crossadmiral deweyshaking palsysquirrel awayadmiralty lawphantasy lifeplantain lily
...View all with 12 letters...
Words (601)
approximatelyautomaticallyfundamentallystatisticallytraditionallyappropriatelypsychoanalystparliamentaryfantasticallysubstantiallyrealisticallystrategicallycategoricallyspectacularlyparadoxicallycomparativelysarcasticallyalternativelypainstakinglyoveranalyzingaestheticallycontractuallyirrationalityencyclopaediapsychoanalyzegrammaticallymarketabilitysensationallyparticularityhallucinatoryextravagantlyaffirmativelyhydraulicallytheatricalityhypercalcemia
...View all with 13 letters...
Phrases (281)
aleatory musicel iskandriyahfamily laridaevaginal arterymyrobalan plumfamily picidaein a similar wayyakut languagebattle of pydnaadmiralty mile
...View all with 13 letters...
Words (443)
psychoanalysissystematicallymetaphoricallyaffectionatelyunderstandablyaccountabilitydemocraticallymathematicallygeographicallyalphabeticallysustainabilityinterplanetarypathologicallycongratulatoryparapsychologypsychoanalyticcharacterologysupernaturallygynaecologicalsatisfactorilyembarrassinglymetaphysicallytelepathicallyscholasticallydiplomaticallyencephalopathyastronomicallyappreciativelyidealisticallyaltruisticallyimpracticalitydepartmentallyarchetypicallybiographicallydiagnostically
...View all with 14 letters...
Phrases (409)
family apiaceaepearl mae baileylachrymal glandbattle of nasebywilliam tyndalefamily ardeidaetubal pregnancypituitary glandsabbatical yearclass scyphozoa
...View all with 14 letters...
Words (361)
extraordinarilyinternationallyinstantaneouslyinappropriatelyanaesthesiologylymphadenopathycrystallizationparentheticallyaerodynamicallymaneuverabilitycardiopulmonarytherapeuticallycompassionatelylackadaisicallyencephalographyunparliamentarydramaturgicallyunacceptabilitypolyunsaturatedinspirationallylogarithmicallygastronomicallyauthoritativelycrystallographyhypochondriacalsympatheticallyarchitecturallydispassionatelydemographicallyheartbreakinglypalaeopathologyritualisticallypsychiatricallytemperamentallyultrasonography
...View all with 15 letters...
Phrases (480)
syringa vulgarischarlotte cordayclass pelecypodaalimentary pasteasamiya languagedialysis machinefamily tinamidaefamily lemnaceaefamily arecaceaeby trial and error
...View all with 15 letters...
Words (168)
enthusiasticallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallypharmaceuticallymonosyllabicallyunapologeticallythermostaticallysurrealisticallyphotographicallyparapsychologistconversationallyhypersalivationsparadigmaticallypornographicallyhymenophyllaceaeparaformaldehydeantistrophicallyextracorporeallyparamagneticallyradiographicallyparaphrasticallyadministrativelyparapsychologiespolysynapticallyapocryphalnessesmalayo-polynesianglossopharyngealarchaeologicallymonosynapticallyarchiepiscopallybureaucraticallyorganizationallyiconoclastically
...View all with 16 letters...
Phrases (449)
in a beastly manneritalian greyhoundfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitycardiac glycosidein an elaborate waychemical analysishypophyseal stalk
...View all with 16 letters...
Words (99)
straightforwardlybacteriologicallyanthropologicallymaterialisticallyelectrostaticallythermodynamicallyphilanthropicallyprobabilisticallyantirevolutionaryradiobiologicallycercidiphyllaceaeunexchangeabilityparaformaldehydeskaleidoscopicallyradioisotopicallyparapsychologistsparasitologicallymonochromaticallyrationalisticallyhypochondriacallypaternalisticallyarchitectonicallyferrimagneticallyunderstandabilitylexicographicallylaryngopharyngealidiosyncraticallycrystallographerscrystallographiesuntranslatabilitytranscriptionallylymphadenopathieshyperalimentationlymphangiographictransdisciplinary
...View all with 17 letters...
Phrases (466)
salvia leucophyllabalaena mysticetuspearly everlastingclass rhodophyceaecoccygeal vertebrafamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusmalaysian language
...View all with 17 letters...
Words (46)
characteristicallyhypercoagulabilitypsychopharmacologypsychopathologicalinterchangeabilitypathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiestransformationallycalymmatobacteriumautobiographicallydiethylmalonylurearecrystallizationsmucopolysaccharideophthalmologicallyglycosaminoglycansoscillographicallyspectrographicallyrepresentationallyultracentrifugallymetallographicallymethylnaphthalenespachycephalosaurusultrarevolutionarypropagandisticallypalaeoanthropologypsychoanalyticallyhydrometallurgicalpsychobiographicalchlamydomonadaceaeintraventricularlyphysiopathologicaldiethylcarbamazine
...View all with 18 letters...
Phrases (434)
bombycilla garrulusfamily physeteridaelachrymal secretionjohn orley allen tatenavigational systemmary wollstonecraftfamily trichechidaefamily asparagaceaecommercial activityfamily desmidiaceae
...View all with 18 letters...
Words (34)
cinematographicallyextralinguisticallyextraterritorialityparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallyindividualisticallypharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyechoencephalographyinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropocentricallyanthropomorphicallycharacterologicallycortico-hypothalamichistopathologicallyphenylpropanolaminehistoriographicallypsychopharmacologicsymptomatologicallydiethylcarbamazinesphytogeographicallycounterinflationarytetramethyldiarsinepaleogeographicallyelectrocardiographypolychromatophiliasPhrases (388)
water-plantain familyacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaeitalian monetary unitlatvian monetary unitclass polyplacophoraalpine type of glacierphytolacca americanafamily lepisosteidae
...View all with 19 letters...
Words (25)
uncharacteristicallyoverenthusiasticallytetrahydrocannabinolradioimmunoassayablecrystallographicallylymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallyphotoautotrophicallyultramicroscopicallyroentgenographicallyencephalomyocarditischemotherapeuticallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiespalatopharyngoplastyplethysmographicallyexistentialisticallyPhrases (375)
william stanley jevonswyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridaedevelopmental anatomy
...View all with 20 letters...
Words (12)
psychopharmacologicalhypogammaglobulinemiamucopolysaccharidosisalkylbenzenesulfonateacetylcholinesteraseselectromyographicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (228)
icelandic monetary unitnikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvania
...View all with 21 letters...
Words (6)
pentamethylenetetrazolelectroencephalographyotorhinolaryngologicalhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (192)
venezuelan monetary unithaliaeetus leucorhyphushydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaeguatemalan monetary unitrhythm and blues musicianbrachycome iberidifoliafamily branchiostomidae
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (137)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandyellowstone national parkcalycanthus occidentaliscanyonlands national parkbangladeshi monetary unitrichard brinsley sheridansciadopitys verticillatatricyclic antidepressant
...View all with 23 letters...
Words (4)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminePhrases (96)
louis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinprivately held corporationbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley masontechnology administrationfederal republic of germany
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (65)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencymelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddington
...View all with 25 letters...
Phrases (56)
brassica oleracea gongylodessubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (44)
business environment analysisamerican revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelco-operative republic of guyananuclear regulatory commissionsecretary of commerce and labortricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (30)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguerevolutionary proletarian armysmall computer system interfacecygnus columbianus columbianusimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (23)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Phrases (23)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiaecalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Phrases (16)
great smoky mountains national parkdigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (12)
pityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
