Words Containing: A,A,I,Y
(In Any Order)
There are 3,538 words,
5,072 phrases and
0 abbr's with
A,A,I,Y in.
Best Scoring Words With: A,A,I,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
taxiway | 7 | 20 | nounn | |||||
noun • a paved surface in the form of a strip; used by planes taxiing to or from the runway at an airport | ||||||||
axially | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • with respect to an axis | ||||||||
fairway | 7 | 16 | nounn | |||||
noun • the area between the tee and putting green where the grass is cut short • the usual course taken by vessels through a harbor or coastal waters • a tract of ground free of obstacles to movement | ||||||||
waylaid | 7 | 14 | verbv | |||||
verb • wait in hiding to attack | ||||||||
amiably | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in an affable manner | ||||||||
animacy | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
cymatia | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
pyaemia | 7 | 14 | nounn | |||||
noun • septicemia caused by pus-forming bacteria being released from an abscess | ||||||||
railway | 7 | 13 | nounn | |||||
noun • line that is the commercial organization responsible for operating a system of transportation for trains that pull passengers or freight • a line of track providing a runway for wheels | ||||||||
myalgia | 7 | 13 | nounn | |||||
noun • pain in a muscle or group of muscles | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (48)
railwayasamiyafairwaywaylaidairplayassyriataiyuangainsayamiablyhypatiataxiwaymyalgianaysaidairwaysrufiyaayautiasanalityanimacyantigaylaniarypitayascymatiaaxiallypyaemiaaliyahspirayasdayanimsokaiyajipyapaachyliajambiyaaplysiayavapaiilkadaycyathia
...View all with 7 letters...
Phrases (3)
die awaytai yuanmaya linWords (133)
analysiscapacitymalaysiacalamitystairwaysanitaryaudacityfatalityhideawaygiveawaydisarrayatypicalraciallyhimalayaamicablyasphyxiabanalityassyrianallayinganalyticmainstayfujiyamafaciallybioassayphysaliaalacrityrailyardsalivarysagacityvariablybayesianstaysailradiallyrapacityaxillary
...View all with 8 letters...
Phrases (17)
sign awaywipe awaypay claimrainy daygive awayfile awayhive awayhail marymain yardpine away
...View all with 8 letters...
Words (240)
basicallyimaginaryamazinglypartiallyanalyzingfairytalehimalayasparalysisauxiliarymagicallyradicallyarbitraryadmiraltymalaysiancandidacyactualityanalysingchlamydiahimalayanhairsprayparalyticanimalityvaliantlybarbarityfairylandancillarypyramidalamaryllisadmirablycausalitycapillaryantipathyupsadaisyrascalityabyssinia
...View all with 9 letters...
Phrases (36)
in a bad waymanila bayappian wayloya jirgaman fridayright awayfamily manwhile awaytea familyin any case
...View all with 9 letters...
Words (357)
mayonnaisetragicallyyugoslaviacapabilityrationallystationarybabylonianinvariablypyromaniacmaniacallyarrhythmiaunsanitaryanalyticalnationallytyrannicalinadequacytacticallycautionaryincapacityhabituallydiagonallymateriallypatriarchymyocardialalarminglyabyssinianasphyxiateparalysinghighwaymanmarginallymalignancyabominablyfamiliarlysalicylateisocyanate
...View all with 10 letters...
Phrases (58)
paris daisyrailway carcanary birdpalm familycall it a daypaying backfading awaylady godivadaily breadfrivol away
...View all with 10 letters...
Words (445)
anniversarypracticallyfinanciallynationalitydaydreamingcalligraphyreactionarydrasticallyaristocracyclairvoyantfamiliaritycataclysmicabnormalityapocalypticfranticallyarbitrarilyrationalityfashionablyaerodynamicorganicallyclassicallyerraticallyhypospadiasmaterialitytachycardiayugoslavianasphyxiatedappallinglyretaliatoryangelicallyunavoidablyantigravityirreparablycarriagewaygraphically
...View all with 11 letters...
Phrases (142)
grass familylaying claimin a broad waylaying wastebryonia albaadmiral byrdplaying areaoryza sativavictoria dayacrylic acid
...View all with 11 letters...
Words (527)
particularlyaccidentallyoccasionallypennsylvaniadramaticallypassionatelysatisfactoryaccompanyingstraightawaymetaphysicalromanticallyartificiallyparamilitarytransylvaniaasphyxiationinflammatorynymphomaniacpatheticallyadditionallyaerodynamicsavailabilityartisticallyanaphylacticmechanicallyasymmetricalanatomicallyacademicallyprobationaryunilaterallyemphaticallyclairvoyancecompanionwayinadequatelyunimaginablyadaptability
...View all with 12 letters...
Phrases (190)
visual acuityscantily cladadmiral deweyshaking palsysquirrel awayadmiralty lawphantasy lifeplantain lilymaterial bodychristmas day
...View all with 12 letters...
Words (579)
extraordinaryapproximatelyautomaticallystatisticallytraditionallyautobiographyappropriatelyparliamentaryradioactivityfantasticallysubstantiallyrealisticallyprecautionarystrategicallycategoricallyparadoxicallycomparativelysarcasticallyalternativelypainstakinglyoveranalyzingaestheticallyirrationalityencyclopaediagrammaticallymarketabilitysensationallyparticularityhallucinatoryaffirmativelyhydraulicallytheatricalityhypercalcemiaapplicabilityparabolically
...View all with 13 letters...
Phrases (273)
aleatory musicel iskandriyahfamily laridaevaginal arteryfamily picidaein a similar wayadvisory boardspiny anteaterprivate treatycardiac rhythm
...View all with 13 letters...
Words (430)
cinematographypsychoanalysissystematicallymetaphoricallyaffectionatelyaccountabilitydemocraticallymathematicallygeographicallyalphabeticallysustainabilityinterplanetarycardiomyopathyunsatisfactorypathologicallypsychoanalyticgynaecologicalsatisfactorilyembarrassinglymetaphysicallytelepathicallyscholasticallydiplomaticallyastronomicallyappreciativelyidealisticallyaltruisticallyimpracticalityarchetypicallybiographicallydiagnosticallyastrologicallyunavailabilitynymphomaniacalquantitatively
...View all with 14 letters...
Phrases (391)
family apiaceaepearl mae baileythoracic cavityorder mysidaceawilliam tyndalefamily ardeidaemyrrhis odoratapituitary dwarfpituitary glandsabbatical year
...View all with 14 letters...
Words (356)
extraordinarilyinternationallyinstantaneouslyinappropriatelyanaesthesiologycrystallizationparentheticallyaerodynamicallymaneuverabilitycardiopulmonarytherapeuticallycompassionatelylackadaisicallyunparliamentarydramaturgicallyunacceptabilityinspirationallylogarithmicallygastronomicallyauthoritativelyhypochondriacalsympatheticallyarchitecturallydispassionatelydemographicallyheartbreakinglyritualisticallypsychiatricallysystematizationaccommodatinglyagranulocytosisapproachabilityunchangeabilityunextraordinarymicroanalytical
...View all with 15 letters...
Phrases (509)
syringa vulgarisby fits and startsalimentary pasteasamiya languagedialysis machinefamily tinamidaeannunciation dayfamily lemnaceaefamily arecaceaeby trial and error
...View all with 15 letters...
Words (169)
enthusiasticallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallypharmaceuticallymonosyllabicallyunapologeticallythermostaticallysurrealisticallyphotographicallyparapsychologistconversationallyhypersalivationsparadigmaticallypornographicallyantistrophicallyparamagneticallyradiographicallynonparticipatoryparaphrasticallyadministrativelyparapsychologiespolysynapticallyparasympatheticsmalayo-polynesianarchaeologicallymonosynapticallyarchiepiscopallybureaucraticallyhypostatizationsorganizationallyiconoclasticallyiconographicallycrystallizations
...View all with 16 letters...
Phrases (463)
tympanic membranein a beastly manneritalian greyhoundfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitycardiac glycosidein an elaborate waychemical analysis
...View all with 16 letters...
Words (97)
straightforwardlybacteriologicallyanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyphilanthropicallyprobabilisticallyantirevolutionaryradiobiologicallycercidiphyllaceaeunexchangeabilitykaleidoscopicallyradioimmunoassaysradioisotopicallyparapsychologistsparasitologicallymonochromaticallyrationalisticallyhypochondriacallypaternalisticallyarchitectonicallyferrimagneticallyunderstandabilitylexicographicallyidiosyncraticallycrystallographiesuntranslatabilitytranscriptionallylymphadenopathieshyperalimentationlymphangiographictransdisciplinary
...View all with 17 letters...
Phrases (495)
salvia leucophyllabalaena mysticetuscuban monetary unitinterstate highwaypearly everlastingfamily dasypodidaelycopus americanussubphylum craniatamalaysian languagecapital of kentucky
...View all with 17 letters...
Words (45)
characteristicallyhypercoagulabilitypsychopathologicalinterchangeabilityhypoparathyroidismpathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiestransformationallycalymmatobacteriumautobiographicallypteridospermaphytadiethylmalonylurearecrystallizationsmucopolysaccharideophthalmologicallyglycosaminoglycansoscillographicallyspectrographicallyaerothermodynamicsrepresentationallyultracentrifugallymetallographicallyultrarevolutionarypropagandisticallypsychoanalyticallyhydrometallurgicalpsychobiographicalintraventricularlyphysiopathologicaldiethylcarbamazinehyperalimentationssemiquantitatively
...View all with 18 letters...
Phrases (493)
bombycilla garrulusadministrative bodydivision anthophytafamily physeteridaeeriobotrya japonicalachrymal secretionafghan monetary unitnavigational systemfamily trichechidaemetric capacity unit
...View all with 18 letters...
Words (40)
hyperparathyroidismcinematographicallyextralinguisticallyextraterritorialityparathyroidectomiesparthenogeneticallyhypoparathyroidismsnonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallyindividualisticallymagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallymercury-contaminatedinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropocentricallyanthropomorphicallycharacterologicallycortico-hypothalamichistopathologicallyphenylpropanolaminehistoriographicallyparasympathomimeticpsychopharmacologicsymptomatologicallydiethylcarbamazinesphytogeographicallycounterinflationary
...View all with 19 letters...
Phrases (439)
water-plantain familyacetylsalicylic acidfamily cyclopteridaescandinavian countryfamily cynoglossidaeitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glacierphytolacca americana
...View all with 19 letters...
Words (26)
uncharacteristicallyoverenthusiasticallytetrahydrocannabinolradioimmunoassayableparathyroidectomizedcrystallographicallylymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallyphotoautotrophicallymagnetohydrodynamicsultramicroscopicallyroentgenographicallyencephalomyocarditischemotherapeuticallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyhyperparathyroidismsPhrases (387)
william stanley jevonshonduran monetary unitwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaemarchantia polymorpha
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiamucopolysaccharidosisacetylcholinesteraseselectromyographicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (268)
icelandic monetary unitnikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unithungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecture
...View all with 21 letters...
Words (4)
otorhinolaryngologicalhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (221)
venezuelan monetary unithaliaeetus leucorhyphushydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaeguatemalan monetary unitrhythm and blues musiciannicaraguan monetary unitsurinamese monetary unit
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (159)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentaliskyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unitsouth korean monetary unittajikistani monetary unit
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineschizosaccharomycetaceaePhrases (116)
louis seymour bazett leakeyargyroxiphium sandwicensemary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medication
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (81)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencybeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (68)
brassica oleracea gongylodeshunting and gathering societysecretary of veterans affairssubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinanewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (51)
business environment analysisamerican revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyananuclear regulatory commissiondeoxyadenosine monophosphatetricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (34)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leagueface-amount certificate companyrevolutionary proletarian armysmall computer system interfacecygnus columbianus columbianus
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (28)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Phrases (24)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaecalymmatobacterium granulomatis
...View all with 30 letters...
Phrases (20)
great smoky mountains national parkdigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (18)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (16)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (13)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay