Words Containing: A,A,E,R,S,S,Y
(In Any Order)
There are 169 words,
769 phrases and
0 abbr's with
A,A,E,R,S,S,Y in.
Best Scoring Words With: A,A,E,R,S,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jackassery | 10 | 26 | nounn | |||||
noun • The foolish or obnoxious behaviour of a jackass. | ||||||||
paraphyses | 10 | 20 | nounn | |||||
noun • a sterile simple or branched filament or hair borne among sporangia; may be pointed or clubbed | ||||||||
paymasters | 10 | 17 | nounn | |||||
noun • a person in charge of paying wages | ||||||||
accessary | 9 | 16 | noun, adjectiven, adj | |||||
noun • someone who helps another person commit a crime adjective satellite • aiding and abetting in a crime | ||||||||
naysayers | 9 | 15 | nounn | |||||
noun • someone with an aggressively negative attitude | ||||||||
manslayers | 10 | 15 | nounn | |||||
noun • a criminal who commits homicide (who performs the unlawful premeditated killing of another human being) | ||||||||
yeasayers | 9 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
paralyses | 9 | 14 | verbv | |||||
noun • loss of the ability to move a body part | ||||||||
hearsays | 8 | 14 | nounn | |||||
noun • gossip (usually a mixture of truth and untruth) passed around by word of mouth adjective satellite • heard through another rather than directly | ||||||||
raygrasses | 10 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (17)
hyperplasiascarboxylasesforestaysailsteeragewaysoveranalysesoveranalysisgrassy-leafedgrassy-leavedparasynapsesstyracaceousdyspareuniascryaesthesiamassotherapyacrocyanosesparapophysesbreathalysesaraeosystylePhrases (8)
mass hysteriadame myra hesssea lyme grassyasser arafatfore staysaileaster sundaynasal syringesidney caesarWords (28)
embarrassedlysaccharomycesmicroanalyseswaywardnessesparasynthesesparasynthesiscarbohydrasesassortativelycryptanalysesforestaysailshyperarousalsnasopharyngesnasopharynxesbradykinesiasparasymbiosesnarcoanalyseshysteromaniastransversallylady's-eardropshypersarcomashyperalgesiasfarawaynessesquarrymasterscrystalisableparapsychosestryparsamidesbreathalysersaraeosystylesPhrases (18)
russian agencytayassu pecariauto accessoryrailway systemzea mays rugosagenus pyraustagenus physarialady's earringsmarsh rosemaryegyptian grass
...View all with 13 letters...
Words (26)
embarrassinglyhyperawarenessankylosaurusestranssexualitydecarboxylaseshyperparasitesapocryphalnesshyaluronidaseshyperaesthesiacocarboxylasestyrannicalnessaddressabilitysphaerocrystalasseveratinglytetrasyllablespsychoanalysertransversalitypolysaccharosecryoanesthesiacryptaesthesiahaemodialysersperissodactylacrystallisableacrasiomycetessarcocystideansarcocystieianPhrases (33)
lacrosse playerdrainage systemgenus chrysaoragenus sphyraenastanley steamerisaac mayer wisesyringa persicasalary increaseitalian cypresssensory aphasia
...View all with 14 letters...
Words (25)
polysaccharideselectroanalysissaccharomycetesagranulocytosesaerodynamicistshyperparasitismreactionaryismsparamyxoviruseselectroanalyseshyperaesthesiastrypanosomiasestyrannosauruseshymenogastralessphaerocrystalssarcoscyphaceaepsychoanalyserspsychoanalyzerspolysaccharosescryoanaesthesiacryptaesthesiassoutheastwardlysarcenchymatousthalassotherapysyllabographiesquadrisyllablesPhrases (30)
general assemblyassembly programgenus dasyproctathree-day measlesapothecary's shopgrass tree familyitalian ryegrasspityriasis roseamarfan's syndromestarry saxifrage
...View all with 15 letters...
Words (14)
surrealisticallyhypersalivationsparapsychologiesparasympatheticsapocryphalnessesglossopharyngealheavyheartednesssemitransparencyhysterocatalepsytyrannicalnesseshyperawarenesseshypercatabolismshyperparasitismsantirecessionaryPhrases (34)
carya illinoensisofficial emissarytyrannosaurus rexinternal analysisspectrum analysisst. lawrence seawaythysanuran insectfamily passeridaeaquila chrysaetosgreat sandy desert
...View all with 16 letters...
Words (5)
crystallographerscrystallographiesglossopharyngealscarboxypeptidasespseudoparenchymasPhrases (54)
class rhodophyceaelycopus americanusoxyura jamaicensisaepyceros melampusjaroslav heyrovskysuspensory bandagejose ortega y gassetgenus hydrodamalisclass gymnospermaesalutatory address
...View all with 17 letters...
Words (4)
mucopolysaccharideslipopolysaccharideshysterosalpingogramschizosaccharomycesPhrases (65)
hydrastis canadensisavogadro's hypothesishydrobates pelagicussolidarity surchargegenus arctostaphylosdisability insurancespanish monetary unitrussian monetary unitdreissena polymorphaphysical restoration
...View all with 19 letters...
Words (7)
overenthusiasticallyradioimmunoassayablelymphogranulomatosesacetylcholinesterasepseudoparenchymatouspsychopharmacologieshyperparathyroidismsPhrases (65)
balaenoptera physalusbyelorussian languageuniversity of nebraskaambystomid salamanderluscinia megarhynchoscross-florida waterwaytransportation systemfamily gasterosteidaesusan brownell anthonysaturday night special
...View all with 20 letters...
Words (1)
encephalomyocarditisesPhrases (48)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsubfamily bassariscidaerhythm and blues musiciansurinamese monetary unitsphyrapicus varius ruberchrysanthemum balsamitaanna mary robertson mosesharvery williams cushing
...View all with 22 letters...
Words (1)
schizosaccharomycetaceaePhrases (34)
louis seymour bazett leakeyargyroxiphium sandwicenseprimary sex characteristicbrassica oleracea botrytissir charles leonard woolleychrysosplenium americanumpresident john quincy adamsprofessional tennis playeraccessory hemiazygous veingenus schizosaccharomyces
...View all with 24 letters...
Phrases (30)
mary wollstonecraft shelleyfrancis scott key fitzgeraldmelanerpes erythrocephalustrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovskywestern samoan monetary unitsudden infant death syndromereticular activating systemsurface-to-air missile system
...View all with 25 letters...
Phrases (27)
brassica oleracea gongylodessecretary of veterans affairsassyrian neo-aramaic languagesystem of weights and measuresbenign prostatic hyperplasiamyrtillocactus geometrizanscasualty care research centerscardinius erythrophthalmusnontricyclic antidepressantpure binary numeration system
...View all with 26 letters...
Phrases (24)
business environment analysisaleksandr sergeyevich pushkinnuclear regulatory commissiontricyclic antidepressant drugcryptobranchus alleganiensistaras grigoryevich shevchenkostationary stochastic processhyacinthus orientalis albulusfalkland islands monetary unithydraulic transmission system
...View all with 27 letters...
Phrases (14)
aleksandr feodorovich kerenskycardiopulmonary resuscitationmaster of arts in library sciencedissident irish republican armysmall computer system interfacearthur stanley jefferson laurelsocial security administrationpneumocystis carinii pneumoniaparasympathetic nervous systemmesembryanthemum crystallinum
...View all with 28 letters...
Phrases (17)
business environmental analysisaleksandr nikolayevich scriabinantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonfrancisco jose de goya y lucientesarrhenius theory of dissociation
...View all with 29 letters...
Phrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionsevere acute respiratory syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trends1st viscount montgomery of alamein
...View all with 30 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoattorney general of the united stateschrysanthemum coronarium spatiosum
...View all with 32 letters...
Phrases (9)
first epistle of paul the apostle to timothysecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay