Words Containing: A,A,D,Y
(In Any Order)
There are 1,453 words,
2,925 phrases and
0 abbr's with
A,A,D,Y in.
Best Scoring Words With: A,A,D,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
kayaked | 7 | 19 | verbv | |||||
verb • To use a kayak, to travel or race in a kayak. • To traverse (a body of water) by kayak. | ||||||||
wayward | 7 | 17 | adjectiveadj | |||||
adjective satellite • resistant to guidance or discipline | ||||||||
headway | 7 | 17 | nounn | |||||
noun • vertical space available to allow easy passage under something • forward movement | ||||||||
hayward | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
washday | 7 | 17 | nounn | |||||
noun • a day set aside for doing household laundry | ||||||||
playday | 7 | 16 | nounn | |||||
noun • time for play or diversion | ||||||||
paydays | 7 | 16 | nounn | |||||
noun • the day on which you receive pay for your work | ||||||||
maydays | 7 | 16 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
academy | 7 | 15 | nounn | |||||
noun • a secondary school (usually private) • an institution for the advancement of art or science or literature • a school for special training • a learned establishment for the advancement of knowledge | ||||||||
mayday | 6 | 15 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (57)
alreadyacademyfaradaydaycarewaywardpayloadheadwaydaresayhaywardwaylaidhalyardroadwaydaystaryardmanwashdayyardarmarrayedumayyadlanyardwaylandyardageallayedkayakedtanyarddramadydaysmannaysaidassayedplaydaypaydaysalcaydedaymarebayardsgaydarsdrayage
...View all with 7 letters...
Phrases (13)
flag dayday caredie awayhardly afast daylast daylady daybag ladyayn randleap day
...View all with 7 letters...
Words (132)
saturdaynowadaysbackyardbroadwaylandladyanalyzedmarylandhandymandaybreakdaydreamaudacityhideawaydisarraybarnyardanalysedworkadayquandaryamygdalaadvocacyfarmyardlackadayboatyardsavoyardcaudallyheadachyrailyardmandalayayurvedafoldawaycharladybastardydamnablyradiallyadorablyadequacy
...View all with 8 letters...
Phrases (29)
natal dayfeast dayfade awayrainy dayday-to-daytea caddydelta raydayton axlunar daynavy yard
...View all with 8 letters...
Words (196)
graduallygraveyardparalyzedhyderabadmandatoryadversaryradicallyparalysedadmiraltycandidacyawkwardlychlamydiadastardlyfairylandpyramidaladmirablyupsadaisyhydrangeascrapyardsalesladyradiantlydysphasiahamadryasalackadayadamantlydysplasiacatalyzedirrawaddydamnatorylaudatorydecayablecrawdaddygraybearddairymaidadjacency
...View all with 9 letters...
Phrases (31)
in a bad wayman fridayready cashyard grasslammas daymarket dayearly daysdayton axedyaus pitabeta decay
...View all with 9 letters...
Words (178)
granddaddychardonnayadequatelyabundantlyinadequacypaddywhackyardmasterdiagonallymyocardialdaydreamerdramaturgyascendancycardplayerlaundrymandefamatorydysarthriaadenopathyunabatedlytalleyrandamygdaloidpardonablysandpaperyanodicallyanalysandsacrylamidedamaginglyreanalyzeddialysatesdaydreamedadjacentlydialyzatesdetachablydysplasiasaffordablyanimatedly
...View all with 10 letters...
Phrases (56)
canada lynxmoshe dayanparis daisycanary birdsugar candyyard markerlead astraysugar daddycall it a dayfading away
...View all with 10 letters...
Words (182)
daydreamingdrasticallyaerodynamichypospadiastachycardiaasphyxiatedsteadfastlyunavoidablyunabashedlyunashamedlyhaphazardlydynamicallypsychodramakinyarwandaanecdotallyparaldehydeadorabilitybradycardiaparathyroidparatyphoidradiographydeclaratoryreadabilitycardiopathybarefacedlymandatorilypyramidicalhazardouslycyclopaediadaydreamerslallygaggeddiaphaneitydisplayableapplaudablyirradicably
...View all with 11 letters...
Phrases (78)
in a broad wayadmiral byrdvictoria dayfree-and-easyacrylic aciddwindle awaymemorial daylaundry cartgrand canyonalkyl halide
...View all with 11 letters...
Words (185)
accidentallydramaticallyadditionallyaerodynamicsacademicallyinadequatelyadaptabilitycarbohydrateradiotherapysporadicallyhaberdasherysadisticallyscandalouslycardiomegalylaundrywomanunpardonablycalculatedlyoveranalyzeddogmaticallypedanticallydiabolicallyadmirabilityabstractedlycardiographyvaletudinaryhebdomadallyamygdaloidalholidaymakerdidacticallyadvisabilityautoantibodybradycardiasachlorhydriashamefacedlyparathyroids
...View all with 12 letters...
Phrases (123)
mary magdalenscantily cladadmiral deweyadmiralty lawmaterial bodychristmas dayascension daydevil-may-caredramatic playfamily boidae
...View all with 12 letters...
Words (160)
extraordinaryfundamentallytraditionallyradioactivityparadoxicallyencyclopaediahydraulicallydisparaginglyadrenalectomyeducationallydiametricallyrhapsodicallyquadrenniallyspasmodicallyembarrassedlydactylographyradioactivelyhalfheartedlyindefatigablypedagogicallydictatoriallyhyaluronidasespreadabilityholidaymakersupgradabilityaerodynamicaldetachabilityadumbrativelyanaphylactoidapodicticallyaffordabilityadjustabilityaperiodicallyclearheadedlysynarthrodial
...View all with 13 letters...
Phrases (151)
el iskandriyahfamily laridaefamily picidaeadvisory boardadvocacy groupbattle of pydnacardiac rhythmadmiralty mileuranyl radicaldwindling away
...View all with 13 letters...
Words (120)
understandablydemocraticallycardiomyopathydiplomaticallyidealisticallydepartmentallydiagnosticallypachydermatousadvantageouslyheavyheartedlygreatheartedlyupgradeabilitypsychoanalyzedparadisiacallyfoundationallyhydrodynamicalantidromicallyadrenergicallyfaintheartedlypolyacrylamideencyclopaediasextrapyramidalaerodynamicistundogmaticallyclairaudientlydecarboxylasesdecarboxylateddecarboxylatesglutaraldehydecyanoethylatedpsychodramatichyaluronidasespolysaccharideparadisaicallybactericidally
...View all with 14 letters...
Phrases (231)
lachrymal glandanthony van dyckanthony vandykeorder mysidaceawilliam tyndalefamily ardeidaemyrrhis odoratapituitary dwarfpituitary glandadmiralty brass
...View all with 14 letters...
Words (108)
extraordinarilylymphadenopathyaerodynamicallycardiopulmonarylackadaisicallydramaturgicallypolyunsaturatedhypochondriacaldispassionatelydemographicallyaccommodatinglyunextraordinaryunadulteratedlyhydromechanicalpolysaccharidesautotetraploidyradioautographyhydroxylapatitesuperabundantlyradiometricallytetrahydrofurandisinflationarytetramethylleadcoeducationallypolyacrylamidesuntraditionallyaerodynamicistsdecarboxylationdecarboxylatingglutaraldehydesdithyrambicallyunanticipatedlypharmacodynamicxeroradiographyineradicability
...View all with 15 letters...
Phrases (321)
by fits and startscharlotte cordayclass pelecypodadialysis machinefamily tinamidaeannunciation dayby trial and errorfamily leporidaewystan hugh audenfamily artamidae
...View all with 15 letters...
Words (47)
rhabdomyosarcomaparadigmaticallyparaformaldehyderadiographicallyadministrativelydenominationallyindefatigabilityhydrocharidaceaehydrocharitaceaedecarboxylationsdodecaphonicallypharmacodynamicsbiodegradabilityechocardiographyheavyheartednessundiplomaticallyadenohypophysealadenohypophysialhyperlipoidaemiacarboxypeptidasephyllostomatidaehendecasyllabicshendecasyllablescardiomyopathiesphotodynamicallyundemocraticallycryptobranchidaeradioimmunoassayancylostomatidaepalaeodendrologypseudoparenchymaradiophotographyhydrodynamicallytranscendentallyhydroxylapatites
...View all with 16 letters...
Phrases (266)
italian greyhoundfamily cyprinidaecardiac glycosidepodocarpus familyalan lloyd hodgkinfamily locustidaefamily balaenidaeexemplary damagesyeoman of the guardfamily elateridae
...View all with 16 letters...
Words (26)
straightforwardlyparathyroidectomycardiorespiratorythermodynamicallyradiobiologicallycercidiphyllaceaeparaformaldehydeskaleidoscopicallyradioimmunoassaysradioisotopicallyhypochondriacallyunderstandabilityidiosyncraticallylymphadenopathiestransdisciplinarysamoyedic-speakingphonocardiographyaerothermodynamicdisadvantageouslycarboxypeptidasesangiocardiographyrhabdomyosarcomaspseudoparenchymasdialectologicallydiaphragmaticallypsychodynamicallyPhrases (284)
dame margot fonteynclass rhodophyceaefamily dasypodidaecylinder separatorfamily trochilidaefamily didelphidaecaesarian deliverycapital of marylandfamily droseraceaehereditary pattern
...View all with 17 letters...
Words (13)
hypoparathyroidismlipopolysaccharidepteridospermaphytadiethylmalonylureamucopolysaccharideaerothermodynamicsheavyheartednessespropagandisticallyrhabdomyosarcomatapseudoparenchymatahydrometallurgicalchlamydomonadaceaediethylcarbamazinePhrases (236)
administrative bodydivision anthophytafamily physeteridaefamily trichechidaefamily desmidiaceaemodal auxiliary verbmarquis de lafayettearthur garfield hayswedding anniversarydylan marlais thomas
...View all with 18 letters...
Words (14)
hyperparathyroidismparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidesindividualisticallymagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidemercury-contaminatedinterdepartmentallydiethylcarbamazinestetramethyldiarsineelectrocardiographyPhrases (250)
acetylsalicylic acidfamily cyclopteridaescandinavian countryfamily cynoglossidaehydrastis canadensisfamily lepisosteidaefamily dasyproctidaebond-trading activityavogadro's hypothesisnancy freeman mitford
...View all with 19 letters...
Words (9)
tetrahydrocannabinolradioimmunoassayableparathyroidectomizedmagnetofluiddynamicsphenylthiocarbamidesmagnetohydrodynamicsencephalomyocarditispseudoparenchymatoushyperparathyroidismsPhrases (222)
honduran monetary unitorder mycelia steriliaorder myxobacterialesfamily trachipteridaedevelopmental anatomydivision tracheophytaclyde william tombaughfamily dermochelyidaedianthus caryophyllussuricata tetradactyla
...View all with 20 letters...
Words (2)
mucopolysaccharidosistetrahydrocannabinolsPhrases (133)
icelandic monetary unitaleksandr solzhenitsyneucalyptus fraxinoidescambodian monetary unitfamily rhinotermitidaesoren aabye kierkegaardsamuel taylor coleridgefamily myrmecophagidaefederal security bureausyngnathus hildebrandi
...View all with 21 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (106)
hydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianbrachycome iberidifoliafamily branchiostomidaeindonesian monetary unitedna saint vincent millayamygdalus communis amara
...View all with 22 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (73)
argyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medicationalfred edward woodley masontechnology administrationfederal republic of germany
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (46)
embryonal rhabdomyosarcomadiamond wedding anniversaryfrancis scott key fitzgeraldcaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndrometympanuchus pallidicinctusarab revolutionary brigadespodkamennaya tunguska river
...View all with 25 letters...
Phrases (41)
brassica oleracea gongylodeshunting and gathering societysubmandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinasubdivision mastigomycotinabureau of diplomatic securitysystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (31)
american revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmeldeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (12)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armynonsteroidal anti-inflammatoryeucalyptus maculata citriodorasocial security administrationerythrocyte sedimentation ratemethamphetamine hydrochloridesubclass heterobasidiomycetes
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (19)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemedward george earle bulwer-lyttonmiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalani
...View all with 29 letters...
Phrases (12)
alexander isayevich solzhenitsyndepository financial institutionethylenediaminetetraacetic acidsevere acute respiratory syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusacute inclusion body encephalitisoccupational safety and health act
...View all with 30 letters...
Phrases (11)
digital communications technology2019-ncov acute respiratory diseasediego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningvladimir vladimirovich mayakovskidefense information systems agency
...View all with 31 letters...
Phrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united statesadult respiratory distress syndrome
...View all with 32 letters...
Phrases (8)
autonomous sensory meridian responsenondepository financial institutionright to speedy and public trial by jurysecretary of health and human servicessubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (7)
attention deficit hyperactivity disordergenerally accepted accounting principlessecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay