Words Containing: A,A,D,M,Y
(In Any Order)
There are 431 words,
1,809 phrases and
0 abbr's with
A,A,D,M,Y in.
Best Scoring Words With: A,A,D,M,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
maydays | 7 | 16 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
academy | 7 | 15 | nounn | |||||
noun • a secondary school (usually private) • an institution for the advancement of art or science or literature • a school for special training • a learned establishment for the advancement of knowledge | ||||||||
mayday | 6 | 15 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
dramady | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
yardman | 7 | 13 | nounn | |||||
noun • worker in a railway yard • a laborer hired to do outdoor work (such as mowing lawns) | ||||||||
yardarm | 7 | 13 | nounn | |||||
noun • either end of the yard of a square-rigged ship | ||||||||
daysman | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
daymare | 7 | 13 | nounn | |||||
noun • A vivid, unpleasant mental image, having the characteristics of a nightmare, during wakefulness. | ||||||||
drayman | 7 | 13 | nounn | |||||
noun • A man who drives drays. • A deliveryman for a brewery. | ||||||||
malady | 6 | 12 | nounn | |||||
noun • any unwholesome or desperate condition • impairment of normal physiological function affecting part or all of an organism | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (47)
mandatoryadmiraltychlamydiapyramidaladmirablyhamadryasadamantlydamnatorydairymaiddaydreamsdaydreamtdaydreamyamygdalescyanamidscandygramdynamicalamygdalinhamadryadamygdalaemandatarycyanamideashamedlyladypalmsmakereadyreadymadeadynamiasalarmedlymyocardiafarmyardsdimyarianamaryllidmamaguyedmysidaceadalmahoyshydromata
...View all with 9 letters...
Phrases (6)
man fridaylammas daymarket daymedal playlady's maiddairy farmWords (50)
yardmastermyocardialdaydreamerdramaturgylaundrymandefamatoryamygdaloidacrylamidedamaginglydaydreamedanimatedlyamendatoryhamadryadsdairymaidscyanamidescandygramsamygdalinsmisassayedreadymadeschlamydialchlamydiaeadactylismamaryllidsadriamycinmastodyniadidynamianmarylandercymatiidaehydromaniamyriapodanheavy-armedmanawyddanamygdalineamygdalatemid-january
...View all with 10 letters...
Phrases (6)
moshe dayanyard markerdata systempalm sundayedna millayfanny adamsWords (55)
daydreamingaerodynamicunashamedlydynamicallypsychodramamandatorilypyramidicaldaydreamersyardmastersmaladroitlyacrylamidesabdominallycondylomatapyramidallyrhabdomancyamygdaloidshamadryadeshamadryasesdeclamatorybipyramidaladriamycinsmastodyniasloadsamoneyhydromaniashochmagandysyndyasmianrhabdomyomacombat-readyfactory-madedactylogramdiametrallyhebdomadarydamnabilitycyphomandraammodytidae
...View all with 11 letters...
Phrases (15)
admiral byrdmemorial daydylan thomasmathew bradymeadow clarythomas hardyyard measurehuman dynamodairy farmermake headway
...View all with 11 letters...
Words (46)
dramaticallyaerodynamicsacademicallycardiomegalylaundrywomandogmaticallyadmirabilityhebdomadallyamygdaloidalholidaymakershamefacedlydaydreamlikepsychodramasdemoniacallygeodynamicalloadsamoneysheadmasterlyachlamydeousdefamatorilylymantriidaelymphadenomahydrodamalismaenadicallydactylogramsamygdalaceaeamygdaliformamygdalotomyeurylaimidaenonmandatorymacrodactylymyliobatidaesalicylamidebiodynamicalpassamaquodybarodynamics
...View all with 12 letters...
Phrases (49)
mary magdalenadmiral deweyadmiralty lawmaterial bodychristmas daydevil-may-caredramatic playfamily boidaemathew b. bradyfamily zeidae
...View all with 12 letters...
Words (47)
fundamentallyadrenalectomydiametricallyspasmodicallyembarrassedlyholidaymakersaerodynamicaladumbrativelyjudgmaticallydeuteranomalydamageabilityintradermallyidiomaticallydemagogicallytetradynamousmaladaptivelyadiathermancydermatographyastrodynamicslymphoadenomadeclamatorilyanti-democracydermatoplastydactylomegalydactyliomancycyanogenamideamygdalaceousmacrodactylusactinomyxidiamacrodactylicmaxillipedarycallionymidaemany-chamberedhaemodialyserhaemodialyses
...View all with 13 letters...
Phrases (71)
family laridaefamily picidaecardiac rhythmadmiralty milecedar mahoganypraying mantidfamily bovidaedna polymeraseamyloid plaquefamily muridae
...View all with 13 letters...
Words (41)
democraticallycardiomyopathydiplomaticallydepartmentallypachydermatoushydrodynamicalantidromicallypolyacrylamideextrapyramidalaerodynamicistundogmaticallypsychodramaticundramaticallyunacademicallyambystomatidaemegalonychidaelymphoadenomasyerwa-maidugurirheumatoidallycyanogenamidespalmately-lobeddiatomophyceaeactinomyxidianmacrodactyliesmacrodactyloushaemodialysershaemodialyzersmyocardiopathyfundamentalityintramedullarychlamydosauruspentadactylismamaryllidaceaehypoadrenalismdiathermaneity
...View all with 14 letters...
Phrases (134)
lachrymal glandorder mysidaceawilliam tyndalefamily ardeidaemyrrhis odorataadmiralty brassnavy departmentadmiralty metalmodal auxiliarybusman's holiday
...View all with 14 letters...
Words (38)
lymphadenopathyaerodynamicallycardiopulmonarydramaturgicallydemographicallyaccommodatinglyhydromechanicalradiometricallytetramethylleadpolyacrylamidesaerodynamicistsdithyrambicallypharmacodynamichemodynamicallythermodynamicalradiochemicallyamaryllidaceousacidimetricallyhyperadrenalismastrodynamicistlymphoadenomatadacrymycetaceaediamagneticallydactyliomanciesunidiomaticallyhamamelidoxylonhyperlipidaemiaadenomyosarcomaaudiometricallyflavourdynamicsphenylacetamidebasidiomycotinaintradermicallypentadactylismschlamydomonades
...View all with 15 letters...
Phrases (220)
dialysis machinefamily tinamidaefamily leporidaefamily artamidaejohn quincy adamsadmiralty islanddiamond jim bradyfamily astacidaefamily triglidaefamily lophiidae
...View all with 15 letters...
Words (21)
rhabdomyosarcomaparadigmaticallyparaformaldehydeadministrativelydenominationallypharmacodynamicsundiplomaticallyhyperlipoidaemiaphyllostomatidaecardiomyopathiesphotodynamicallyundemocraticallyradioimmunoassayancylostomatidaepseudoparenchymahydrodynamicallycalcium-cyanamidemicroradiographymelodramaticallydiagrammaticallytetramethylleadsPhrases (184)
family cyprinidaepodocarpus familyfamily locustidaefamily balaenidaeexemplary damagesyeoman of the guardfamily elateridaefamily blenniidaefamily pythonidaezea mays indentata
...View all with 16 letters...
Words (11)
parathyroidectomythermodynamicallyparaformaldehydesradioimmunoassayslymphadenopathiessamoyedic-speakingaerothermodynamicrhabdomyosarcomaspseudoparenchymasdiaphragmaticallypsychodynamicallyPhrases (193)
dame margot fonteynfamily dasypodidaefamily trochilidaefamily didelphidaecapital of marylandfamily droseraceaesubsidiary companyhexadecimal systemfamily engraulidaesubfamily turdinae
...View all with 17 letters...
Words (10)
hypoparathyroidismpteridospermaphytadiethylmalonylureamucopolysaccharideaerothermodynamicsrhabdomyosarcomatapseudoparenchymatahydrometallurgicalchlamydomonadaceaediethylcarbamazinePhrases (158)
administrative bodyfamily physeteridaefamily trichechidaefamily desmidiaceaemodal auxiliary verbmarquis de lafayettedylan marlais thomasfamily meliphagidaeapodemus sylvaticusfamily motacillidae
...View all with 18 letters...
Words (11)
hyperparathyroidismparathyroidectomieshypoparathyroidismsmucopolysaccharidesmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidemercury-contaminatedinterdepartmentallydiethylcarbamazinestetramethyldiarsinePhrases (176)
family cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaenancy freeman mitfordfamily polypodiaceaesubfamily perdicidaeedna st. vincent millayfamily calliphoridaegerard manley hopkins
...View all with 19 letters...
Words (8)
radioimmunoassayableparathyroidectomizedmagnetofluiddynamicsphenylthiocarbamidesmagnetohydrodynamicsencephalomyocarditispseudoparenchymatoushyperparathyroidismsPhrases (159)
honduran monetary unitorder mycelia steriliaorder myxobacterialesfamily trachipteridaedevelopmental anatomyclyde william tombaughfamily dermochelyidaefamily pseudococcidaeambystomid salamanderorder actinomycetales
...View all with 20 letters...
Words (1)
mucopolysaccharidosisPhrases (96)
icelandic monetary unitcambodian monetary unitfamily rhinotermitidaesamuel taylor coleridgefamily myrmecophagidaecape verde monetary unitacanthocybium solandrivladimir ilyich ulyanovjordanian monetary unitdominican monetary unit
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (74)
hydrated aluminium oxidefamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianbrachycome iberidifoliafamily branchiostomidaeindonesian monetary unitedna saint vincent millayamygdalus communis amaraparliamentary procedure
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (51)
argyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medicationalfred edward woodley masontechnology administrationfederal republic of germanyandrei andreyevich gromyko
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (34)
embryonal rhabdomyosarcomadiamond wedding anniversarycaulophyllum thalictroidessudden infant death syndrometympanuchus pallidicinctuspodkamennaya tunguska rivernational academy of sciencesdevelopmentally challengedsystematic desensitisationsystematic desensitization
...View all with 25 letters...
Phrases (28)
submandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinasubdivision mastigomycotinabureau of diplomatic securitysystem of weights and measuresentandrophragma cylindricumcalycophyllum candidissimumscardinius erythrophthalmus
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (22)
american revolutionary leaderorder of our lady of mount carmeldeoxyadenosine monophosphatesecretary of commerce and laborfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission systemsysteme international d'unitesdactylorhiza maculata fuchsiipleomorphic rhabdomyosarcoma
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (11)
cardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armynonsteroidal anti-inflammatoryeucalyptus maculata citriodorasocial security administrationerythrocyte sedimentation ratemethamphetamine hydrochloridesubclass heterobasidiomycetestime-delay measuring instrument
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (9)
automatic data processing systemmiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisondecimal system of classificationmaturity-onset diabetes mellitusunited states army special forcesPhrases (1)
enzyme-linked-immunosorbent serologic assay