Words Containing: A,A,D,E,R,Y
(In Any Order)
There are 461 words,
1,709 phrases and
0 abbr's with
A,A,D,E,R,Y in.
Best Scoring Words With: A,A,D,E,R,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| daycare | 7 | 13 | nounn | |||||
noun • childcare during the day while parents work | ||||||||
| daymare | 7 | 13 | nounn | |||||
noun • A vivid, unpleasant mental image, having the characteristics of a nightmare, during wakefulness. | ||||||||
| yardage | 7 | 12 | nounn | |||||
noun • distance measured in the aggregate number of yards | ||||||||
| drayage | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| already | 7 | 11 | adverbadv | |||||
adverb • prior to a specified or implied time | ||||||||
| daresay | 7 | 11 | ||||||
verb • To venture to say, to think something probable. | ||||||||
| arrayed | 7 | 11 | verb, adjectivev, adj | |||||
adjective satellite • in ceremonial attire and paraphernalia | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (42)
graveyardparalyzedhyderabadadversaryparalysedhydrangeagraybeardpaygradesdaydreamsdaydreamtdaydreamyunarrayedkaleyardsadrenallydaybreaksbayadeersbayaderesradiatelydefrayalsayurvedasmakereadyreadymadealarmedlyyajur-vedayajurvedalatter-dayseawardlyanhydrasewaste-yardwasteyardready-madedryadelladarraynedpaediatrydaytalers
...View all with 9 letters...
Phrases (7)
ready cashmarket dayearly daysdrive awaygray aldereaster daylay readerWords (46)
yardmasterdaydreamercardplayerdefamatorytalleyrandsandpaperyacrylamidereanalyzeddaydreamedamendatoryhydrangeasdisarrayedgraybeardsdefrayablereadymadesgraveyardscaryatidespaederastymarylanderanhydrasesreanalyseddrainlayerdasyuridaeharassedlyheavy-armedtyrannidaeeastwardlyhyracoideayear-arounderadicablycypraeidaehydraemiasaldermanrymatsyendragray-haired
...View all with 10 letters...
Phrases (17)
yard markerlead astraydaily breadbreak of dayday laborercarded yarnquarter daydart playercathode raycanary seed
...View all with 10 letters...
Words (51)
daydreamingaerodynamicparaldehydedeclaratoryreadabilitybarefacedlydaydreamersyardmastersacrylamidescardplayersdisparatelyballyraggedhamadryadeshamadryasesdeclamatoryhexahydrateadverbiallywaywardnesshydralazineretardatorydrainlayersdyspareuniaaepyornidaecombat-readyhyracoideanfactory-madediametrallyhebdomadaryaleyrodidaewavy-grainedaldermanitypachydermalcyanuramidebreadthwaysarytaenoids
...View all with 11 letters...
Phrases (31)
free-and-easymemorial daymathew bradycaraway seedveterans' daymeadow clarygandy dancercalendar dayprayer beadsready to hand
...View all with 11 letters...
Words (67)
aerodynamicscarbohydrateradiotherapyhaberdasherycardiomegalyoveranalyzedabstractedlyvaletudinaryholidaymakerheavyheartedrehydratabledrapeabilitydisagreeablycadaverouslyhardheadedlyineradicablydeflationarycarbohydrasedaydreamlikeoctahedrallyheraldicallycarboxylatedhydralazineswallydraiglesacerdotallyhexahydratesarchdeaconryparaldehydestriradiatelyheadmasterlygrassy-leafedgrassy-leavedbradykinesiadefamatorilyhydrobatidae
...View all with 12 letters...
Phrases (41)
mary magdalenadmiral deweymaterial bodydevil-may-caregrand larcenymathew b. bradyacademy awardarmistice dayordinary careresidual clay
...View all with 12 letters...
Words (62)
extraordinaryadrenalectomydiametricallyquadrenniallyembarrassedlyradioactivelyhalfheartedlyhyaluronidasespreadabilityholidaymakersaerodynamicaladumbrativelyaperiodicallyclearheadedlywaywardnessestetrahedrallydeuteranomalycarbohydrasescarbohydratesdecarboxylasedecarboxylatedeclarativelyintradermallyexasperatedlystraitlacedlyadversativelyexaggeratedlygrandfatherlywallydraiglestetradynamoushydrangeaceaebradykinesiasdasyproctidaeadiathermancydermatography
...View all with 13 letters...
Phrases (67)
el iskandriyahfamily laridaeadmiralty milecedar mahoganyradiant energydata hierarchydna polymerasecretan dittanybenzyl radicalfamily muridae
...View all with 13 letters...
Words (45)
understandablydemocraticallydepartmentallypachydermatousheavyheartedlygreatheartedlyupgradeabilityadrenergicallyfaintheartedlypolyacrylamideextrapyramidalaerodynamicistclairaudientlydecarboxylasesdecarboxylateddecarboxylatesglutaraldehydehyaluronidasespolysaccharidebactericidallyhydroxyapatiteaddressabilitycaryophyllidaeyerwa-maiduguripersuadabilityaerohydroplanedactylographerrheumatoidallymacrodactylieshaemodialysershaemodialyzersperissodactylaintramedullaryquadrisyllableamaryllidaceae
...View all with 14 letters...
Phrases (102)
order mysidaceafamily ardeidaenavy departmentadmiralty metalfamily turdidaedrainage systemdata encryptionfamily bramidaefamily rallidaedynamic speaker
...View all with 14 letters...
Words (52)
extraordinarilyaerodynamicallypolyunsaturateddemographicallyunextraordinaryunadulteratedlyhydromechanicalpolysaccharidesautotetraploidyhydroxylapatitesuperabundantlyradiometricallytetrahydrofurantetramethylleadpolyacrylamidesaerodynamicistsdecarboxylationdecarboxylatingglutaraldehydesxeroradiographyineradicabilityideographicallythermodynamicalallotetraploidyradiochemicallyhydroxyapatitesradiotelegraphyextrajudiciallydisagreeabilityamaryllidaceousacidimetricallyichthyosauridaehyperadrenalismdacrymycetaceaepterodactylidae
...View all with 15 letters...
Phrases (172)
charlotte cordayby trial and errorfamily leporidaefamily artamidaefamily triglidaeradial asymmetrymacleaya cordatazea mays indurataorder alcyonariaalexandre yersin
...View all with 15 letters...
Words (23)
paraformaldehydeadministrativelyhydrocharidaceaehydrocharitaceaedecarboxylationsbiodegradabilityechocardiographyheavyheartednesshyperlipoidaemiacarboxypeptidasecardiomyopathiesundemocraticallycryptobranchidaepalaeodendrologypseudoparenchymatranscendentallyhydroxylapatitesmelodramaticallythelypteridaceaeununderstandablytetrahydrofuranstetramethylleadslepidobotryaceaePhrases (131)
italian greyhoundfamily cyprinidaecardiac glycosideexemplary damagesyeoman of the guardfamily elateridaequaternary periodgrand canyon stategrand mal epilepsyaerodynamic force
...View all with 16 letters...
Words (9)
parathyroidectomycardiorespiratorythermodynamicallycercidiphyllaceaeparaformaldehydesunderstandabilityaerothermodynamiccarboxypeptidasespseudoparenchymasPhrases (168)
dame margot fonteynclass rhodophyceaecylinder separatorfamily trochilidaecaesarian deliveryfamily droseraceaehereditary patternfamily engraulidaeafrican yellowwoodsubfamily turdinae
...View all with 17 letters...
Words (9)
lipopolysaccharidepteridospermaphytadiethylmalonylureamucopolysaccharideaerothermodynamicsheavyheartednessespseudoparenchymatahydrometallurgicaldiethylcarbamazinePhrases (152)
administrative bodyfamily physeteridaefamily trichechidaemodal auxiliary verbmarquis de lafayettearthur garfield hayswedding anniversaryphoenix dactyliferaorder sauropterygiaeducation secretary
...View all with 18 letters...
Words (11)
hyperparathyroidismparathyroidectomiesmucopolysaccharideslipopolysaccharidesmagnetohydrodynamicphenylthiocarbamidemercury-contaminatedinterdepartmentallydiethylcarbamazinestetramethyldiarsineelectrocardiographyPhrases (165)
family cyclopteridaehydrastis canadensisfamily dasyproctidaeavogadro's hypothesisnancy freeman mitfordhydrobates pelagicussubfamily perdicidaesolidarity surchargedisability insurancefamily calliphoridae
...View all with 19 letters...
Words (8)
tetrahydrocannabinolradioimmunoassayableparathyroidectomizedphenylthiocarbamidesmagnetohydrodynamicsencephalomyocarditispseudoparenchymatoushyperparathyroidismsPhrases (151)
honduran monetary unitorder mycelia steriliaorder myxobacterialesfamily trachipteridaedivision tracheophytafamily dermochelyidaesuricata tetradactylaambystomid salamanderorder actinomycetalesamyloid protein plaque
...View all with 20 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (78)
hydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianbrachycome iberidifoliafamily branchiostomidaeindonesian monetary unitparliamentary procedurehenry engelhard steinway
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (56)
argyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medicationalfred edward woodley masontechnology administrationfederal republic of germany
...View all with 24 letters...
Phrases (37)
embryonal rhabdomyosarcomadiamond wedding anniversaryfrancis scott key fitzgeraldcaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromearab revolutionary brigadespodkamennaya tunguska rivermachine readable dictionary
...View all with 25 letters...
Phrases (33)
brassica oleracea gongylodeshunting and gathering societycharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securitysystem of weights and measuresentandrophragma cylindricumconjunctival layer of eyelidshereditary cerebellar ataxiascardinius erythrophthalmus
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (27)
american revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelsecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission system
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (12)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armynonsteroidal anti-inflammatoryeucalyptus maculata citriodorasocial security administrationerythrocyte sedimentation ratemethamphetamine hydrochloridesubclass heterobasidiomycetes
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemedward george earle bulwer-lyttonmiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (9)
alexander isayevich solzhenitsyndepository financial institutionethylenediaminetetraacetic acidsevere acute respiratory syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusdame agatha mary clarissa christiePhrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united statesadult respiratory distress syndrome
...View all with 32 letters...
Phrases (7)
attention deficit hyperactivity disordergenerally accepted accounting principlessecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
