Words Containing: A
There are 164,968 words,
51,361 phrases and
450 abbr's with
A in.
Best Scoring Words With: A
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| pizzazz | 7 | 45 | nounn | |||||
noun • the activeness of an energetic personality | ||||||||
| zyzzyva | 7 | 43 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| pizazzy | 7 | 39 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| pizazz | 6 | 35 | nounn | |||||
noun • Flair, vitality, or zest; energy; vigor. | ||||||||
| pazazz | 6 | 35 | nounn | |||||
noun • Flair, vitality, or zest; energy; vigor. | ||||||||
| jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| bezazz | 6 | 35 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| pizzaz | 6 | 35 | nounn | |||||
noun • the activeness of an energetic personality | ||||||||
| jazzman | 7 | 34 | nounn | |||||
noun • a musician who plays or composes jazz music | ||||||||
| jacuzzi | 7 | 34 | nounn | |||||
noun • A hot tub or whirlpool bath with underwater jets that massage the body. verb • To equip with a jacuzzi. • To use a jacuzzi. • To treat with a jacuzzi. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
aWords (1894)
thatwhathavewantyeahtakebackokaymakesaidmeancallwaitawaytalkthanlastnamemadestaycamehearsamecaremanydeadbabyrealalsoplayheaddaysyearhardidea
...View all with 4 letters...
Phrases (7)
to a ta fewa lota bitet alet al.fa laAbbreviations (293)
ninathairosalenaabelnasaasapmarimajagael
...View all with 4 letters...
Words (5791)
aboutgonnathankagaingreatafterleavemaybeyearsplacetodaywomanhappywannaalonereadyheardstartgottahavenlaterwatchheartcrazywatercausedeathhandsspeakmeanspartyleastshallstandbreak
...View all with 5 letters...
Phrases (60)
by farin allon airadd toadd upat baymany av-e dayand soof age
...View all with 5 letters...
Abbreviations (16)
Mar-17Mar-19Mar-02Mar-25Jan-01Jan-19Aug-01Jan-20Aug-15Jan-06
...View all with 5 letters...
Words (10805)
reallypleasealwaysfatheraroundthankswantedfamilycalledmattersayinganyonechangehavinghappenanywaytakingafraidmakingalmostchancescaredanswerreasoncannotaskingmasterladiesrathernormalcaughtattackhandlebecamecamera
...View all with 6 letters...
Phrases (339)
air baghard upsea godstay onjan husrack upcon mandrag uphip padtv star
...View all with 6 letters...
Abbreviations (3)
ask.comomega-3omega-6Words (17063)
becauseanothertalkingalreadywaitingexactlymarriedanymorehusbandagainstalrightleavingplayingspecialcompanyanybodycarefulperhapsstrangefinallychangedcallingcaptainexplainimaginetotallymistakestationteacheramericadarlingmessageinsteadamazinggeneral
...View all with 7 letters...
Phrases (939)
air basename tagw. c. handyby hearttea gownw. h. audensea gullspear upair cellbody pad
...View all with 7 letters...
Abbreviations (3)
08-May-4515-Aug-45lgbtqia+Words (22298)
anythingactuallywhateverdaughterprobablyhospitalstraightbirthdaylaughingwatchingamericanaccidentmarriagespeakinganywherethousandpleasurestandingpersonalstartingpregnantbathroommilitaryfavoritelanguagepracticeupstairsnationaljapanesealthoughhandsomemountaintraininggreatestprepared
...View all with 8 letters...
Phrases (1913)
white antauto tiresea floorhot plateleave outmary janein a flashnatal dayold latinfree fall
...View all with 8 letters...
Words (24381)
beautifulimportantyesterdayhappeningchristmasdangerousattentionsituationafternooncertainlyapartmentscreamingnecessaryfantasticaccordingbreakfastapologizeoperationcharacterhappinessbrilliantpoliticalgentlemanchocolateinsurancecelebratecarefullybreathingcigarettebasicallymountainsdisappearcommanderassistanttreatment
...View all with 9 letters...
Phrases (2908)
salary cutlouis kahnin a bad waysing alongsmall beerfelis oncasmall boatlittle aukmanila baycone shape
...View all with 9 letters...
Words (22564)
understandabsolutelyespeciallyappreciatesweetheartrestaurantdepartmentlieutenantapparentlydownstairspersonallyeventuallyparticularcaliforniawashingtonafterwardsreputationgenerationchatteringattractivebackgroundatmospherethreatenedcommercialindividualphotographinvitationbasketballunderneathpopulationofficiallymedicationconstantlyreasonableappearance
...View all with 10 letters...
Phrases (3791)
swage blockcanada lynxoff-the-rackshah of iranabel tasmanyves tanguytea essencepole weaponmarking inkoff-the-wall
...View all with 10 letters...
Words (18928)
informationimmediatelycomfortablegrandfathergrandmothercomplicatedappointmentperformanceconcentrateembarrassedimaginationexplanationtemperatureanniversarythreateningpersonalitypracticallyauthoritiesapproachingtransferredfascinatingnecessarilyappropriatecomplainingtechnicallyinvestigatecelebratingtraditionalmagnificentcertificatecombinationcelebrationdestinationcommunicateassociation
...View all with 11 letters...
Phrases (4334)
humphry davyisaac singeraquila rapaxbarack obamaname dropperpearl harborpole vaultergenus lycosagrass familygreat revolt
...View all with 11 letters...
Words (14580)
relationshipconversationprofessionalunbelievableembarrassingdisappointedorganizationparticularlyphotographerheadquarterssurveillancechampionshipannouncementpsychiatristspecificallycivilizationpresentationaccomplishedaccidentallyregistrationinstrumentalintellectualcongratulateoccasionallytransmissionthanksgivingsatisfactionconfidentialrefrigeratorkindergartenphiladelphiapresidentialentertainingarchitecturecompensation
...View all with 12 letters...
Phrases (4602)
carnauba palmchlorophyll agraham greenespace capsulehard-to-pleasetrouble makerathene noctuapole vaultingalec guinnessmeasuring rod
...View all with 12 letters...
Words (10545)
unfortunatelyinvestigationinternationalunderstandingcircumstancesextraordinaryuncomfortableentertainmentcommunicationinvestigatingpsychologicalrevolutionarydemonstrationconcentrationgranddaughterapproximatelysophisticatedinterrogationestablishmentgrandchildreninappropriateassassinationconsiderationunderestimateenvironmentaldisappearanceautomaticallymisunderstandembarrassmentdeterminationauthorizationunpredictabledisappointingcontroversialreincarnation
...View all with 13 letters...
Phrases (4699)
telegraph postjohn masefieldbakke decisionupton sinclairpartial breachdwarf chestnutgenus blaberusharvey cushingaleatory musicpaul hindemith
...View all with 13 letters...
Words (7206)
administrationcommunicationsrepresentativeidentificationtransportationdisappointmentrecommendationtransformationinterpretationpharmaceuticalunderstandablesimultaneouslyrepresentationrehabilitationprofessionallydiscriminationadministrativeconstitutionalscientificallyreconciliationinfrastructurecharacteristicreconnaissanceunprofessionalczechoslovakiahypotheticallycongratulationaccomplishmentclaustrophobiccinematographyuncontrollableslaughterhousecircumstantialarchaeologicalpsychoanalysis
...View all with 14 letters...
Phrases (4726)
leave of absencefamily apiaceaegalileo galileiimperative formalpine clubmossitalian capitalbasque languagenegeri sembilanpassover suppergenus pelecanus
...View all with 14 letters...
Words (4717)
congratulationselectromagneticstraightforwardpsychologicallyconfidentialityextraordinarilyrevolutionariesinternationallycinematographerprofessionalismexperimentationunconditionallyinsubordinationextracurricularpsychotherapistdissatisfactionmethamphetaminetechnologicallynotwithstandingunintentionallyacknowledgementinstantaneouslysynchronizationenvironmentallypithecanthropusdecontaminationophthalmologistconfrontationalpersonificationentrepreneurialinappropriatelymonounsaturatedunsophisticatedhospitalizationdisenfranchised
...View all with 15 letters...
Phrases (4443)
malaria parasitemeasuring devicesyringa vulgarisallium carinatumauditory ossiclepanel discussionby fits and startsstay of executionteutoburger waldiridaceous plant
...View all with 15 letters...
Words (1718)
misunderstandingextraterrestrialunconstitutionalenthusiasticallyintercontinentalenvironmentalistindiscriminatelydisqualificationautobiographicalanesthesiologistelectromagnetismmultimillionairepheochromocytomadisproportionateneurotransmittergastrointestinaltransilluminatorundersecretariesconstitutionallytranscontinentalcharacterizationmisappropriationaustralopithecusenvironmentalismmultidimensionalprestidigitationcatastrophicallycountersignaturetriphenylmethanetransubstantiatenoncommunicationrepresentationalcircumambulatingdiscombobulationunpredictability
...View all with 16 letters...
Phrases (3770)
tympanic membranemultiengine planecommedia dell'arteczar alexander iiigenus utriculariaarteria vaginalisbattle of marathonmanihot esculentacapital of finlanddame kiri te kanawa
...View all with 16 letters...
Words (983)
institutionalizedindistinguishablestraightforwardlydepersonalizationtelecommunicationconversationalistcommercializationindustrializationmisinterpretationintergovernmentalmisidentificationunconventionalitybacteriologicallyimmunosuppressanttranscendentalisminstitutionalisedmisrepresentationelectrocardiogramconstitutionalityanthropologicallycompartmentalizedparathyroidectomymaterialisticallytransilluminationconsubstantiationintellectualizingcardiorespiratorytriskaidekaphobiaelectrostaticallycontemporaneouslythermodynamicallyincommunicabilityinconsequentiallytranscendentalistphilanthropically
...View all with 17 letters...
Phrases (3366)
horizontal sectioncapital of ethiopiathrough and throughwilliam stricklandcastilian languagegopherus agassiziiheat of sublimationjacqueline cochranweather forecastermanihot utilissima
...View all with 17 letters...
Words (512)
telecommunicationscharacteristicallydisproportionatelycompartmentalizinginternationalizinganthropomorphizinginconsequentialityhypercoagulabilitygastroenterologisttransubstantiationpsychopharmacologyoversimplificationtransmogrificationpsychopathologicalantivivisectionistinstitutionalizinghyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitysociopsychologicalneuropsychologicalpaleoclimatologistinexpugnablenessespolyesterificationexterritorialitieshypersensitizationpolymorphonuclearsradiochromatogramscommensurabilitiesmisidentificationsspectroheliographselectrodynamometercommercializationscounterstrategists
...View all with 18 letters...
Phrases (2818)
hindu calendar monthabel janszoon tasmanbombycilla cedrorunbombycilla garrulusarteria vertebraliswashington monumentoceanites oceanicusdouble-deck carriageprofessional golfererinaceus europaeus
...View all with 18 letters...
Words (313)
hyperparathyroidismhydrochlorothiazidecountertransferencesternocleidomastoidpsychophysiologicalpseudohermaphroditeintellectualizationpneumoencephalogramcinematographicallystraightforwardnesspolyesterificationsdisenfranchisementshypersensitizationsextralinguisticallycountersurveillanceextraordinarinessesprofessionalisationknowledgeablenessesotorhinolaryngologyextraterritorialityprofessionalizationantivivisectionistsparathyroidectomiesultracentrifugationsurface-assimilativecommunicativenesseshypolipoproteinemiaparthenogeneticallycompanionablenesseshypoparathyroidismsdispassionatenessespostmillenarianismscrosslinguisticallynonrelativisticallycompassionatenesses
...View all with 19 letters...
Phrases (2148)
water-plantain familymeasuring instrumentacetylsalicylic acidfavourable receptionbattle of marston moormuscular contractionerinaceus europeaeusallium cepa viviparumaquilegia canadensisbronislaw malinowski
...View all with 19 letters...
Words (145)
counterrevolutionaryuncharacteristicallycompartmentalizationinstitutionalizationhypercholesterolemiaanthropomorphizationoverenthusiasticallyinternationalizationtetrahydrocannabinolelectroencephalogramparadichlorobenzenessemiautobiographicalspectroheliographiesradioimmunoassayablekeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenessunsatisfactorinessescrystallographicallyreconceptualizationshyperadrenocorticismindistinguishabilitycounterdemonstrationcytodifferentiationslymphogranulomatosestransformationalistsimmunocytochemicallylymphogranulomatosisdistinguishabilitiesintellectualizations
...View all with 20 letters...
Phrases (1663)
william stanley jevonssweet-scented geraniumarcheological remainsallium cepa aggregatumpelecanus onocrotalusblack-capped chickadeecalendula officinalisgilbert charles stuarthonduran monetary unityellow-shafted flicker
...View all with 20 letters...
Words (60)
electroencephalographpsychopharmacologicalhypogammaglobulinemiadisestablishmentarianotorhinolaryngologistextraterritorialitiescompartmentalizationsinstitutionalizationsstereomicroscopicallymultidimensionalitiesconstructive-metabolicstraightforwardnessesmucopolysaccharidosisestablishmentarianismalkylbenzenesulfonateinterchangeablenessesconstitutionalizationelectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalelectroencephalogramscontemporaneousnessesadrenocorticosteroidsadrenocorticotrophinsphosphoglyceraldehydeotorhinolaryngologiesmeningoencephalitideselectromyographicallydendrochronologicallyovercommercializationinternationalizationselectroretinographiesanthropomorphizationsphotolithographically
...View all with 21 letters...
Phrases (1236)
use of goods and servicesacrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentalabelmoschus esculentusadministrative hearingelimination tournamenthead and shoulders abovedissolution of marriage
...View all with 21 letters...
Words (26)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismreinstitutionalizationconstitutionalizationsdeinstitutionalizationelectroencephalographselectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineencephalomyocarditisescountercountermeasuresdihydroxyphenylalanineestablishmentarianismsindistinguishabilitiescounterinterpretationsPhrases (904)
venezuelan monetary unitadministrative districtadministrative divisiongregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphusadministrative officialtransient global amnesiaschlumbergera truncatuscoronavirus disease 2019
...View all with 22 letters...
Words (14)
electroencephalographicnonrepresentationalismshydrochlorofluorocarbonreinstitutionalizationselectroencephalographerdeinstitutionalizationscarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiaPhrases (650)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatesecond battle of el alameingeorge macaulay trevelyanposterior pituitary glandchlorpheniramine maleateto all intents and purposes
...View all with 23 letters...
Words (11)
microgramma-piloselloideslaryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (502)
basque homeland and freedomcarnegie mellon universityprofessional organisationprofessional organizationlouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophyta
...View all with 24 letters...
Words (4)
immunoelectrophoreticallyphosphatidylethanolaminesuvulopalatopharyngoplastyantiestablishmentarianismPhrases (358)
count ferdinand von zeppelinunited states secret serviceembryonal rhabdomyosarcomacluster of differentiation 4myroxylon balsamum pereiraecosmic microwave backgroundbalaenoptera acutorostratabureau of justice assistanceigor fyodorovich stravinskybureau of justice statistics
...View all with 25 letters...
Phrases (253)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichsir sarvepalli radhakrishnan
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (171)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transduceroffice of management and budget
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (155)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksgallinula chloropus cachinnans
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (114)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers association
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (82)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligence
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (80)
united states public health servicegreat smoky mountains national parkbureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrundigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdi
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (53)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciation
...View all with 32 letters...
Phrases (47)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemoncongress of industrial organizationslycopersicon esculentum cerasiforme
...View all with 33 letters...
Phrases (41)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicus
...View all with 34 letters...
Phrases (32)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation party
...View all with 35 letters...
Phrases (27)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television system
...View all with 36 letters...
Phrases (27)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independenceal-jama'a al-islamiyyah al-muqatilah bi-libyatheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime prevention
...View all with 37 letters...
Phrases (13)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban development
...View all with 38 letters...
Phrases (14)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (13)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security network
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
