Words Containing: _,_,H,I,M,R,T
(In Any Order)
There are 2,706 words,
2,393 phrases and
0 abbr's with
_,_,H,I,M,R,T in.
Best Scoring Words With: _,_,H,I,M,R,T
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
rhythmized | 10 | 31 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
rhythmizes | 10 | 30 | verbv | |||||
Valid word for Scrabble US
| ||||||||
rhythmize | 9 | 29 | verbv | |||||
Valid word for Scrabble US
| ||||||||
mythicizer | 10 | 29 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
rhizotomy | 9 | 26 | nounn | |||||
noun • surgical procedure in which spinal nerve roots are cut; done (anterior roots) to relieve intractable pain or (posterior roots) to stop severe muscle spasms | ||||||||
exothermic | 10 | 24 | adjectiveadj | |||||
adjective • (of a chemical reaction or compound) occurring or formed with the liberation of heat | ||||||||
thermalize | 10 | 24 | verbv | |||||
verb • To lower the velocity and kinetic energy of fast neutrons in a nuclear reactor by use of a moderator, and thus increase the efficiency of fission | ||||||||
shmaltzier | 10 | 24 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
arrhythmic | 10 | 23 | adjectiveadj | |||||
adjective satellite • lacking a steady rhythm • without regard for rhythm | ||||||||
rhythmical | 10 | 23 | adjectiveadj | |||||
adjective • recurring with measured regularity | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
mirthWords (57)
meredithrhythmicthermitemightiersmithersthereminhermeticmouthierstroheimmithraichumoristhermiticmirthfulhermitryteraphimhemipterrightismtriumphsarythmiasmitheryisothermmistruthisarithmrhematichumituretrimorphthoriumsbothriumchromitehamartiathermionthermitstrampisharythmicmisthrew
...View all with 8 letters...
Phrases (3)
hard timelight armmata hariWords (136)
christmasnightmarechemistrybirthmarkhermitagealgorithmhematuriathrumminghailstormtriumphalmatriarchmotheringhamstringtrondheimchromaticrheumaticlogarithmwordsmithdiathermythermidormirthlessrhythmicschromatinmotorshipbiorhythmhumoristsrhytidometriumphedhardimentironsmitheremitishintermesherythemiceurythmichamartias
...View all with 9 letters...
Phrases (12)
jim thorperoom lightgrain mothtiger mothmother witwhite roomrim blightthe pamirstirich mirfort smith
...View all with 9 letters...
Words (238)
pharmacisttriumphantarithmeticrheumatismsmotheringthumbprintarrhythmiaamateurishenrichmentmonarchistthrombosishumoristicmetaphoricrheumatoidshirtmakermillwrightarrhythmicpromethiumexothermicrhythmicalmetternichmatriarchytriphammerhumiliatorkhitmutgarmotherlikethermionicisothermalmastershipmicrolightdichromatehematocritmachinatorachromaticmirthfully
...View all with 10 letters...
Phrases (24)
thorium-228three timeswitch broompernyi mothwhite broomstrike homewhat is moreright prismright smartmoth miller
...View all with 10 letters...
Words (362)
atmosphericforthcomingcharismaticnourishmenthypothermiasmithereenschristendommisanthropenightmarishshortcomingsympathizerhypothermicmoonlightermetamorphicgarnishmentinterahamwelogarithmicendothermiclamplightersympathiserhermeneuticmccarthyismhammersteinalgorithmicprothrombinorchiectomymisanthropylutheranismmegatheriumsilversmithnorthumbriamesothoriumdysrhythmiamatriarchalthatcherism
...View all with 11 letters...
Phrases (34)
great schismarctiid mothhouse martinsimhat torahbirth traumaazimuth markstraight manharvest timearies the ramright atrium
...View all with 11 letters...
Words (399)
humanitarianheadmistressbiochemistrymetaphoricalrhythmicallyamphitheatertriumphantlyheartwarmingamphitheatrechronometrichermeticallyhyperthermiaarithmeticalpsychometrichyponatremiachromaticismamphotericinphototropismmithridatismhomeothermiccharlatanismthrombolysisenshrinementatmosphericsmisanthropicerythromycinenantiomorphephemeralitypoikilothermtrichromaticmirthfulnessmotherlinessdeciphermentlachrymosityachromatized
...View all with 12 letters...
Phrases (81)
run-of-the-millmolly pitcherchristmas boxmissel thrushchristmas daypoetic rhythmanimal starchsmart as a whiparthur millermusic teacher
...View all with 12 letters...
Words (413)
metamorphosiscraftsmanshipsportsmanshipchristmastimehermaphroditepetrochemicaldiaphragmaticrefurbishmentthyroidectomymitochondrialthermoplasticthermodynamicmonochromaticmouthwateringhermeneuticaltransshipmentreplenishmentimmunotherapythermosettingnightmarishlypolychromaticmorphogeneticcinematographmitochondriondraftsmanshippharmaceuticschemisorptionactinomorphichypermetropiaharmonizationdeciphermentscharlatanismsmetamorphismscatastrophismphototropisms
...View all with 13 letters...
Phrases (124)
grain merchantbreathing timecardiac rhythmanhima cornutafriction matchchristmas cakechristmas giftbritish empirechristmas treesir thomas more
...View all with 13 letters...
Words (377)
pharmaceuticalcinematographymetaphoricallycardiomyopathythermodynamicsmicrochemistryrelinquishmentschoolmistresspharmacologisthermaphroditicimpoverishmentphantasmagoriadermatographichypothyroidismheadmastershiphydropneumaticelectrochemistmalnourishmentanthropometricdisheartenmentmonochromatismchromaticitieschemoreceptiondisfurnishmentheadmistresseshypermetropiasmetamorphosinghandicraftsmanhandicraftsmenhypercriticismchemoreceptivetheatricalismsarithmeticallycinematographshyperpigmented
...View all with 14 letters...
Phrases (126)
myrrhis odorataischemic strokechristmas bellsflight maneuverprimary featherachromatic lenschromatic colorarthur mitchellarithmetic meanmother superior
...View all with 14 letters...
Words (306)
cinematographercinematographicphotojournalismanthropomorphicenfranchisementstereochemistrymicrophotographphotomultiplierlogarithmicallyhumanitarianismelectrochemicalamphitheatricalimperishabilitychromatographichermaphroditismblameworthinessreestablishmentechinodermatousschoolmasterishmetallographiesthyroidectomiesanthropometriesthromboplastinsposthemorrhagicalgorithmicallymerchantabilitydithiocarbamatemischaracterizedisheartenmentsimpoverishmentspsychometricianstoichiometrieshyperstimulatedhyperstimulatesphotoperiodisms
...View all with 15 letters...
Phrases (149)
high temperatureimperial mammothvictor-marie hugorhythmic patternachromatic colorcantering rhythmchemical reactorbartholomeu diasbartholomeu diazfeather geranium
...View all with 15 letters...
Words (136)
hemorrhoidectomytriphenylmethaneundernourishmentchemotherapeuticpharmaceuticallytrichotillomaniathermostaticallythrombocytopeniaelectrochemistryanthropomorphismanthropomorphiseanthropomorphizeunderachievementauthoritarianismnorthamptonshirethermolabilitiesradiochemistriesspectroheliogramthermometricallythermoperiodismsmicrogametophytepolyrhythmicallythermoplasticityhyperstimulatingthermoregulatingheterometabolismhyperstimulationthermoregulationparasympatheticshyperthyroidismshypervitaminosesmonochromaticitythrombocytopenicthromboembolismsthyroidectomized
...View all with 16 letters...
Phrases (168)
photographic filmachillea ptarmicamephitis macrouraatrium of the heartmetric weight unitjohn simmons barthchristmas diseasegenus antirrhinumantirrhinum majuscatholic monarchs
...View all with 16 letters...
Words (85)
parathyroidectomythermodynamicallyelectromechanicaldextroamphetaminethermoluminescentradiochromatogramspectroheliogramsthermoperiodicityhyperstimulationsthermoregulationsdisfranchisementsthermostabilitiesmonochromaticallythrombocytopeniasmorphogeneticallystereochemistriesmachine-controlledhyperalimentationimmunochemistriesauthoritarianismspharmacognosticalpharmacotherapiesnephelometricallychromatographicalelectrochemicallybiogeochemistriesmechanoreceptionsimperishabilitiestriphenylmethanesblameworthinesseschromolithographyaerothermodynamicelectromyographicmerchantabilitieshandcraftsmanship
...View all with 17 letters...
Phrases (193)
competence hearingclomiphene citrateczech monetary unitwilliam wordsworthsubphylum craniataotto fritz meyerhoffamily trochilidaedianthus plumariustrichechus manatusearth-received time
...View all with 17 letters...
Words (55)
anthropomorphizingspectrophotometrichyperaldosteronismdisenfranchisementthermoluminescenceradiochromatogramsthermoplasticitiesmonochromaticitiessphygmomanometriesarchaeoastronomiesthrombophlebitideshypoparathyroidismrechromatographiesrechromatographingstoichiometricallypteridospermaphytatrichlormethiazidediethylmalonylureamacrophotographieshypercholesteremiahydroflumethiazidechemotherapeuticalelectrochemistriesmechanochemistriesaerothermodynamicselectromyographieshandcraftsmanshipsmetallographicallymethylprednisoloneoverembellishmentsphotomicrographiesphotomorphogenesisnitrochloromethanedextroamphetamineshydrometallurgical
...View all with 18 letters...
Phrases (234)
hindu calendar monthgenus struthiomimustuamotu archipelagofamily physeteridaeorthotomus sutoriusdame sybil thorndikelachrymal secretionafghan monetary unitjohn pierpont morgansir martin frobisher
...View all with 18 letters...
Words (46)
hyperparathyroidismpseudohermaphroditecinematographicallythermoluminescencesdisenfranchisementsthermoperiodicitiesspectrophotometriesparathyroidectomieshypolipoproteinemiahypoparathyroidismscomprehensibilitiesanarcho-collectivismimmunocytochemistrymagnetohydrodynamicphenylthiocarbamidechromatographicallychromoblastomycosisneuropharmacologistelectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalitymethylprednisolonesanthropomorphicallyincomprehensibilitycortico-hypothalamicradiopharmaceuticalhomotransplantationhydrometeorologicaldihydrostreptomycinhydrometeorologistschromolithographersparasympathomimeticchromolithographieschromolithographing
...View all with 19 letters...
Phrases (199)
phytolacca americanastephen michael reichathyrium filix-feminaathyrium pycnocarponchinese monetary unittransmission channelthalarctos maritimusrobert wilhelm bunsentragelaphus imberbisbritish monetary unit
...View all with 19 letters...
Words (31)
hypercholesterolemiaanthropomorphizationsemiautobiographicalradiopharmaceuticalsspectrophotometricalparathyroidectomizedhyperadrenocorticismlymphogranulomatosisphenylthiocarbamidespseudohermaphroditicoophorosalpingectomyglomerulonephritidesneuropharmacologistshyperlipoproteinemiamagnetohydrodynamicsimmunohistochemistrymicroelectrophoresesmicroelectrophoresismicroelectrophoreticencephalomyocarditisantiauthoritarianismchemotherapeuticallyhomotransplantationsmicrophotometricallypsychopharmacologisthypercholesterolemicdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsmischaracterizationsPhrases (192)
honduran monetary unitphotographic emulsionfamily trachipteridaesecond coming of christmarchantia polymorphaamphitheatrum flaviumbenjamin henry latrobeislamic calendar monthgeorges henri lemaitremilton snavely hershey
...View all with 20 letters...
Words (13)
disestablishmentarianimmunocytochemistriesimmunoelectrophoresesimmunoelectrophoreticestablishmentarianismpseudohermaphroditismelectromyographicallyimmunoelectrophoresisanthropomorphizationsincomprehensibilitiesantiauthoritarianismshypercholesterolemiaspsychopharmacologistsPhrases (180)
acrocentric chromosomesir john everett millaisadministrative hearinghelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumhelichrysum bracteatumarchitectural ornamenthungarian monetary unitketorolac tromethamine
...View all with 21 letters...
Words (9)
disestablishmentariansspectrophotometricallyimmunohistochemistriesintercomprehensibilityhexamethylenetetramineencephalomyocarditisesestablishmentarianismsmicrospectrophotometermicrospectrophotometryPhrases (143)
gregorian calendar monthredevelopment authorityhydrated aluminium oxidebarbara wertheim tuchmaninstrument of punishmentmultiple mononeuropathysodium tripolyphosphatebattle of the bismarck searhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (5)
hexamethylenetetraminesdichlorodifluoromethanehypobetalipoproteinemiamicrospectrophotometersmicrospectrophotometricPhrases (113)
family threskiornithidaetransient ischemic attacktribasic sodium phosphatechlorpheniramine maleateelectromechanical devicekazakhstani monetary unitthiopentobarbital sodiumsir william rowan hamiltongottfried wilhelm leibnizhenri emile benoit matisse
...View all with 23 letters...
Words (6)
hyperbetalipoproteinemiaintercomprehensibilitiesmicroelectrophoreticallydichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (73)
primary sex characteristicbattle of the spanish armadadmitri ivanovich mendeleevarthur meier schlesinger jr.gottfried wilhelm leibnitzantiarrhythmic medicationrichard buckminster fullertechnology administrationcomprehensive examinationmohorovicic discontinuity
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyantiestablishmentarianismPhrases (65)
symphoricarpos orbiculatuscruel and unusual punishmentdistinguished service medalfriedrich wilhelm nietzschemodest petrovich mussorgskypolystichum acrostichoidesbeggar-my-neighbour strategysaddam bin hussein at-takritithermoelectric thermometercaulophyllum thalictroides
...View all with 25 letters...
Phrases (58)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanx-linked dominant inheritancedorothy mary crowfoot hodgkinadrenocorticotropic hormonejames abbott mcneill whistleremployee stock ownership planandrei dimitrievich sakharovcharles maurice de talleyrandrevolutionary calendar month
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (39)
electromechanical transduceraugustus welby northmore puginjerusalem artichoke sunfloweradrenocorticotrophic hormonethyrotropin-releasing hormonehomo sapiens neanderthalensisthrough empirical observationgeorge iii of the united kingdommachaeranthera tanacetifoliatheodore herman albert dreiser
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (40)
marcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydemocratic republic of the congofederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitysergei mikhailovich eisensteindissident irish republican army
...View all with 28 letters...
Phrases (24)
chemical decomposition reactionfriedrich wilhelm august froebeldmitri dmitrievich shostakovichcapital of the dominican republicsao thome e principe monetary unitferdinand joseph la menthe mortonhydrangea macrophylla hortensispresident william henry harrisonrene antoine ferchault de reaumurgeorges joseph christian simenon
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (17)
valentina vladmirovna tereshkovaethylenediaminetetraacetic acidaugust friedrich leopold weismannwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornplasma thromboplastin antecedentesther hobart mcquigg slack morrishenri rene albert guy de maupassantalfred charles william harmsworthsisters of st. michael the archangel
...View all with 30 letters...
Phrases (12)
marie louise elisabeth vigee-lebrunanicius manlius severinus boethiusprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontarmenian apostolic orthodox churchluigi barnaba gregorio chiaramontinorth american free trade agreementsecurities and exchange commissionvocational rehabilitation program
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (12)
hierarchical classification systemstraight-line method of depreciationsodium ethylmercurithiosalicylateprimary subtractive colour for lightedmond louis antoine huot de goncourtlymphocytic choriomeningitis viruswilhelm apollinaris de kostrowitzkiprogressive emphysematous necrosisbosnian-herzegovinian monetary unitchrysanthemum coronarium spatiosum
...View all with 32 letters...
Phrases (11)
characteristic root of a square matrixbureau of alcohol tobacco and firearmsmusculus sphincter ductus choledochidisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanneridiopathic thrombocytopenic purpuraharakat al-jihad al-islami al-filastiniamaranthus hybridus hypochondriacus
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticihermann ludwig ferdinand von helmholtzfederal home loan mortgage corporationdepartment of health and human servicesbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberdeclining balance method of depreciation