Words Containing: _,_,E,K,L,S,Y
(In Any Order)
There are 232 words,
317 phrases and
0 abbr's with
_,_,E,K,L,S,Y in.
Best Scoring Words With: _,_,E,K,L,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jaywalkers | 10 | 27 | nounn | |||||
noun • a reckless pedestrian who crosses a street illegally | ||||||||
flyspecked | 10 | 25 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
squeakily | 9 | 25 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
freakishly | 10 | 23 | adverb, adjectiveadv, adj | |||||
adverb • unpredictably | ||||||||
flyspecks | 9 | 23 | nounn | |||||
noun • a tiny dark speck made by the excrement of a fly adjective satellite • very small | ||||||||
newsweekly | 10 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
peckishly | 9 | 23 | adverb, noun, adjectiveadv, n, adj | |||||
Valid word for Scrabble US
| ||||||||
flyspeck | 8 | 22 | verb, nounv, n | |||||
noun • a tiny dark speck made by the excrement of a fly adjective satellite • very small | ||||||||
skylighted | 10 | 22 | adjectiveadj | |||||
adjective • Furnished with one or more skylights | ||||||||
weakishly | 9 | 22 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (46)
sylphlikesyruplikeskylarkerirksomelywalkyriesankylosedberserklyyarmelkesyarmulkeskaleyardsweakishlylatchkeyssketchilystreakilymalarkeysflyspecksshylockedkilobytesskylarkedyeastlikekryoliteseyeblackseyeblinksankylosespalsylikevalkyriessqueakilyalkylateseyestalkssatyrlikepeckishlybulldykesstylebookscreakilykeybugles
...View all with 9 letters...
Phrases (3)
lake nyasalyre snakelady's leekWords (37)
mistakenlyrecklesslyfreakishlycocksurelyskylarkersskylightedsneakinglyskeletallystylebooksplaymakershyperlinksleukocytesflyspeckedkilocyclessemiweeklyfecklesslyjaywalkersnewsweeklykindlesslykeyloggersklondykersscythelikesneakishlyflystrikeslucklesslyspeakinglyflunkeyishflunkeyismstrokeplaykeelyvineskaryolysesunshakenlystrickenlyforsakenlykallitypes
...View all with 10 letters...
Phrases (8)
isle of skyesafety lockalkyd resinkeyhole sawstroke playkrebs cyclesleepy dickblue sky lawWords (42)
honeysuckleunspeakablyskulduggerykinesiologysickeninglyskepticallyoutspokenlyflyspeckingyokefellowsbricklayerslymphokineslickerishlytracklayerskaryologieskittenishlythanklesslychelyabinskskuldudderysnakeblennyself-mockeryflunkeydomsflunkeyismsyellowbacksshriekinglyyellowbarksyellowcakesmistakeablylooyenworkskosteletzyathelytokiesthelytokoustracklesslysqueakinglyunshakeablybialystoker
...View all with 11 letters...
Phrases (15)
louis leakeyglossy snakemackerel skyclosely knitcelery stickleon trotskysystem clockskeleton keyloosely knitmalt whiskey
...View all with 11 letters...
Words (26)
skullduggeryhoneysucklescytoskeletonleukocytosiscytoskeletalleukocytoseshypokalemiaskeratoplastypinnywinkleshoneysuckledblackish-greycockyleekiesgreyish-blacktiddleywinkspennywinklesalkalescencyladylikenessfernyticklessparkleberrydusky-coloredpoikilocytespancake-stylelocksmitherycycloalkanestiggywinklesquicksilveryPhrases (9)
lickety splitalfred kinseyslippery dickall-day suckerrayleigh diskrusty gracklesalt lake cityskittle alleysilky terrierWords (9)
holidaymakerscytoskeletonsgobbledygookstiddledywinksfairnyticklesklyuchevskayaunmistakeablydusky-colouredsketchabilityPhrases (23)
el iskandriyahwhiskey bottlesilky wisteriayellowish pinksnake polypodyblended whiskylaundry basketgenus buckleyakeyboard shelfcolobus monkey
...View all with 13 letters...
Words (10)
leukodystrophyphytoplanktersankylosaurusesearthshakinglycantankerouslyleukocytosisesblackberryingsvelvety-skinnedyekaterinoslavladylikenessesPhrases (24)
blackberry bushskeletal systemblended whiskeyemily dickinsonbishop berkeleysleepy sicknessblack raspberryostyak languagestanley kubrickrockrose family
...View all with 14 letters...
Words (6)
kinestheticallyankylostomiasescholecystokininlymphoblast-likehuckleberryingsdiphenylketonesPhrases (20)
erlenmeyer flaskalfred korzybskisecurity blanketwilliam shockleygenus myxinikelahydraulic brakesswamp blackberrysprinkler systemlashkar-e-tayyibanickel-base alloy
...View all with 15 letters...
Words (5)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsPhrases (28)
strictly speakinghypophyseal stalkelwyn brooks whitetrackless trolleycoral honeysucklecomstock mealybugsonoran lyre snakesystema skeletalekallman's syndromehall's honeysuckle
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (17)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parkthomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemthin-leaved stringybarkpeter ilich tchaikovskylymphoblastic leukemiaaustralian honeysuckle
...View all with 21 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay