Anagrams of: INEE_
There are 252 words,
0 phrases and
119 abbr's that can be made from
INEE_.
Did you mean?
Containing I,N,E,E,_ (any order)
Containing I,N,E,E,_ (any order)
Best Scoring Anagrams of: INEE_
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| zein | 4 | 13 | nounn | |||||
noun • A protein derived from corn/maize, having many industrial applications. | ||||||||
| zine | 4 | 13 | nounn | |||||
noun • A low-circulation, non-commercial publication of original or appropriated texts and images, especially one of minority interest. | ||||||||
| zee | 3 | 12 | nounn | |||||
noun • the 26th letter of the Roman alphabet | ||||||||
| exine | 5 | 12 | nounn | |||||
noun • The outer layer of a pollen grain or spore; the exosporium | ||||||||
| zin | 3 | 12 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| qi | 2 | 11 | adverb, nounadv, n | |||||
noun • the circulating life energy that in Chinese philosophy is thought to be inherent in all things; in traditional Chinese medicine the balance of negative and positive forms in the body is believed to be essential for good health | ||||||||
| nixe | 4 | 11 | ||||||
Valid word for Scrabble US
| ||||||||
| jin | 3 | 10 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| jee | 3 | 10 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| nix | 3 | 10 | verb, nounv, n | |||||
noun • a quantity of no importance; thing (object:), singular, negative pronoun; pronoun, thing, singular; quantifier: negative existential verb • command against | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! | ||||||||
5 Letters
4 Letters
Words (82)
beenneedevennicefineseenminelinewineninekneegenekeenpineedendineerinteenveinvineenidbenereinliennenetinesinebenicineneempeenkinebineneveeidemienmenereenzeinweendeneeyendenineepnitepeinerneseneesneeynegienneifnevinidenixezineainebeinbiendeeneevneinaeineenesenewetenfeenfeniideemeinneteniedniefniesnife
Load more...Abbreviations (8)
