PUSH-DOWN LIST Synonyms
There are 2 synonyms of the phrase
push-down list.
(exact relations)
There are 6 hypernyms of the phrase push-down list. (close relations)
There are 6 hypernyms of the phrase push-down list. (close relations)
Did you mean?
Definition of PUSH-DOWN LIST
Definition of PUSH-DOWN LIST
Best Alternative Words for PUSH-DOWN LIST
| Expand? | Word | Save? | More Syns.. | Usage | Type | |||
|---|---|---|---|---|---|---|---|---|
| stack | verb, nounv, n | |||||||
noun • an orderly pile • (often followed by `of') a large number or amount or extent • a list in which the next item to be removed is the item most recently stored (LIFO) • a large tall chimney through which combustion gases and smoke can be evacuated • a storage device that handles data so that the next item to be retrieved is the item most recently stored (LIFO) verb • load or cover with stacks • arrange in stacks • arrange the order of so as to increase one's winning chances | ||||||||
| push-down stack | nounn | |||||||
noun • a list in which the next item to be removed is the item most recently stored (LIFO) | ||||||||
Best Hypernyms For PUSH-DOWN LIST
Here is a list of related hypernyms for
push-down list, these are close relations that fall within the same topic. Most relevant words are highlighted and in order.
Words (5)
list
array
collection
listing
sequence
Phrases (1)
data structureAlternatives for STACK
Words (40)
heappilemassaccumulationaggregationarrayassemblageassortmentbunchclustercollectioncongregationcumulationgatheringgrouphoardmoundstockpilestoregerrymandersmashwreckbatchdealflockhatfullotmessmicklemintmountainmucklepasselpeckplentyraftsightslewsmokestackspatePhrases (10)
build upstack upgood dealgreat dealpush-down listpush-down stackpush-down storagepush-down storequite a littletidy sum
