9-Letter Words Containing: YMA
(In Exact Order)
There are 42 9 letter words,
3 9 letter phrases and
0 9 letter abbr's with
YMA in.
Best Scoring 9 Letter Words With: YMA
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| enzymatic | 9 | 25 | adverb, adjectiveadv, adj | |||||
adjective • of or relating to or produced by an enzyme | ||||||||
| ribozymal | 9 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| quarryman | 9 | 23 | nounn | |||||
noun • a man who works in a quarry | ||||||||
| mollymawk | 9 | 23 | nounn | |||||
noun • large web-footed birds of the Southern Hemisphere having long narrow wings; noted for powerful gliding flight | ||||||||
| polymathy | 9 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| haymakers | 9 | 21 | nounn | |||||
noun • a farm machine that treats hay to cause more rapid and even drying • a hard punch that renders the opponent unable to continue boxing | ||||||||
| playmaker | 9 | 20 | nounn | |||||
noun • a player in a team sport who leads attacks or maneuvers in such a way that a teammate can score | ||||||||
| lachrymal | 9 | 19 | adjectiveadj | |||||
adjective • of or relating to tears • relating to or located near the organ that produces tears | ||||||||
| polymaths | 9 | 19 | nounn | |||||
noun • a person of great and varied learning | ||||||||
| ecthymata | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words With YMA In Order
Words (42)
clergymanboogeymanplaymakerpaymasterhaymakingpantrymanlachrymalenzymaticquarrymandairymaidplaymatespolymathsecthymatareadymadeshantymanvestrymanependymasribozymalmollymawkgraymailssafetymanhaymakerspolymathyliverymansalarymanspymasterhickymalslymantriawaymarkedassay-markisocrymalpolymastystaymakerwherrymancymagraphflymakersjurymaststoponymalready-madelacrymalstrionymalependymalPhrases (3)
family manby machinecyma recta
