9-Letter Words Containing: Y,A,C,H
(In Any Order)
There are 206 9 letter words,
25 9 letter phrases and
0 9 letter abbr's with
Y,A,C,H in.
Best Scoring 9 Letter Words With: Y,A,C,H
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| schmaltzy | 9 | 28 | adjectiveadj | |||||
adjective satellite • effusively or insincerely emotional | ||||||||
| mycorhiza | 9 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| paychecks | 9 | 25 | nounn | |||||
noun • a check issued in payment of wages or salary | ||||||||
| mycophagy | 9 | 25 | nounn | |||||
noun • the practice of eating fungi (especially mushrooms collected in the wild) | ||||||||
| wheyfaced | 9 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hackberry | 9 | 23 | nounn | |||||
noun • any of various trees of the genus Celtis having inconspicuous flowers and small berrylike fruits • small edible dark purple to black berry with large pits; southern United States | ||||||||
| hatchways | 9 | 23 | nounn | |||||
noun • an entrance equipped with a hatch; especially a passageway between decks of a ship | ||||||||
| archduchy | 9 | 23 | nounn | |||||
noun • the domain controlled by an archduke or archduchess | ||||||||
| wheyfaces | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| pachyderm | 9 | 22 | nounn | |||||
noun • any of various nonruminant hoofed mammals having very thick skin: elephant; rhinoceros; hippopotamus | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (206)
physicianmachineryhierarchytreacheryhydraulicarchetypescholarlychlamydiaethicallyoligarchychantillyarchenemypanchayatcacophonychrysalislymphaticbellyachecharybdisyachtsmanayahuascaschmaltzypachydermsycophantchocolatyhesitancychandlerychicanerythackerayhackneyedpsychicalaeschylusstaunchlytheocracyapocryphascyphozoahypomaniclachrymalhackberrytachypneachrysalidhaecceityphagocytephlyctenalogomachypaycheckshelicallyphysicalshypobaricgynarchicwheyfacedchirimoyayachtsmencattishlyhyracoidsdichogamymycophagycymophanelechayimscaddishlyhaystacksecthymatateacherlyanchylosechammyingheadacheyhatchwaysarchduchyohmicallypentarchyhagiarchyathrocytelatchkeystetrarchycymographstarchilyyachtingshypocaustchiralitywheyfaceschatoyanthyacinthsbycatchespreachifydysphagicpatchoulydysphasiccoryphaeisciamachyalchymiestachylyteheptarchytachyonicthylacinetrachearybeachboyscherimoyahyperacidepochallypreachilyhydracidsnamaycushcataphyllmycorhizatrachytesraunchilytrachyticpachytenechampertymarshalcydyarchieschambraysmyopathichydrocastwatcheyestachylitediachronyteachablychlamydesethnarchychlamysesaldehydiccharcoalytheomachyanthocyanhypothecalycophytaschooldaycraythurschromakeychayrootssnatchilydyschroasdyschroiaacrophonycatholytelychgatespolyarchystrychniagraphiclyscythemantyphaceaeallicholychuprassychairdaysmonomachysynechiaspothecarymatchplaymischancyfratchetycymagraphchurchwaybrachyurableacheryayahuascopsychogasparchedlyhickymalschipewyanmycophagechalybitedyscheziacynancheschyackinguncharityfishybackchyluriaseucryphiahairybackcryopathyharuspicycopygraphxerochasyhaemocytesciomachybrancherychalybeanstachyseschrysaoraadhocracysynanthicchrysanthhydrazoicpyracanthdiachylondiachylumcampeachyhercogamytheocrasynymphicalhalcyonicarhythmicstachyosephycocyanchiyogamipanchayetpunchayetcreophagyphylarchsphylarchywanchancyarchitypetheomancyhydnaceaearchologyskiamachyPhrases (25)
by machineholy placeready cashhue and cryhenry clayspeech dayrock hyraxwych hazelmatch playtray clothhoney cakechase awayschool daycowboy hatchen n. yanggray birchpetty casheasy chairhard candyhybrid carday schoolyacht clubyacht racechina clayshaggy cap
