Dictionary Only:
Profanity Off:

9-Letter Words Containing: S,S,Y

 (In Any Order)
There are 644 9 letter words, 34 9 letter phrases and 0 9 letter abbr's with S,S,Y in.

Best Scoring 9 Letter Words With: S,S,Y

Expand?WordSave?LengthUsagePointsType
physiques9
26 nounn
noun

• constitution of the human body

• alternative names for the body of a human being

zymolyses9
26 nounn
noun

• a process in which an agent causes an organic substance to break down into simpler substances; especially, the anaerobic breakdown of sugar into alcohol

zymolysis9
26 nounn
noun

• a process in which an agent causes an organic substance to break down into simpler substances; especially, the anaerobic breakdown of sugar into alcohol

lysozymes9
26 nounn
noun

• an enzyme found in saliva and sweat and tears that destroys the cell walls of certain bacteria

joysticks9
25 nounn
noun

• a lever used by a pilot to control the ailerons and elevators of an airplane

• a manual control consisting of a vertical handle that can move freely in two directions; used as an input device to computers or to devices controlled by computers

jackstays9
25 nounn
noun

• A stay (rope, bar or batten), running along a ship's yard, to which is attached the head of a square sail.

• A cable between two ships or from a ship to a fixed point which can be used to support a load during transfer of personnel or materiel along the cable.

• A line (rope, webbing or cable), attached to a boat at the ends, to which a safety harness can be clipped to restrain falling in rough conditions and to prevent falling overboard.

• (underwater diving) A line fixed at both ends, which may be used to guide a load or a diver along the route of the line. Uses include guidance to and from the underwater work site, and as a means of controlling an underwater search.

asphyxias9
24 nounn
noun

• a condition in which insufficient or no oxygen and carbon dioxide are exchanged on a ventilatory basis; caused by choking or drowning or electric shock or poison gas

squashily9
24 adverb, adjectiveadv, adj
Valid word for Scrabble US
asphyxies9
24 nounn
Valid word for Scrabble US
systemize9
23 verbv
verb

• arrange according to a system or reduce to a system

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 9 Letter Words

Words (644)
seriouslynecessarymysteriesnecessityendlesslyphysicistaccessoryspeakeasypsychosisparalysisecosystemsymbolismaimlesslysymposiumexpresslymassivelyhystericsmysticismsalisburysynthesisselfishlysyllogismuselesslysymbiosispassivelyhemolysischrysalisassuredlysymbolisebypassingwyszynskisubsystemupsadaisycrosswaysabyssiniaviscositysensuallystylishlysophistrycasuistrydysgenicsnystagmussynovitisjanissaryleastwayssalesladypussyfootstylisticaeschyluspassivitysisypheanpyrolysissystemizesymphysisslantwaysautolysismydriasisdysphasiaankylosissynopsiseartlesslyhomeynesssymbolistsymbolicsslavishlydysplasiablessedlydionysiusgodlesslymoneylesscassowaryhydrastiscaryopsisunstylishdiaphysissannyasinglueynesscatalysissinuosityassiduitysynergismepiphysislawlesslysyllogistsymbiosesloyalismsloyalistsptyalismsplaysuitsserotypeshobbyistsquaysidescatalysesrallyistscatalystslipolysesanalysersoverstaysstairwaysphysicalsjoylesslyyuckinesssulfonylsspeedwayssurveyorssoapsudsyparalysesfairyismsflysheetssuasivelyskydiversyumminessphysiquessyrphiansshynessesnonglossyhysteriassybaritesnaysayerssystalticrowdyismsbioassaysdyscrasiasyngamousaislewaystypecastsmystifiesmystiquessinuouslyskysurfedskysurfercoynessesbystreetscastawayslyricistsmainstayscypressesparoxysmsroyalistschymosinshemolysesessayistsasphyxiassynergistwastewaysapophysesswinishlycysteinesepiphysesassumedlysingsongysoothsaysresurveysglycosylssynopsizehaystacksbodysurfscausewayseyeshadesdyestuffssayonarassyntagmasslynessesjoystickspassersbyunessayeddynamismssynthesesdailynesssinlesslysannyasiscaryopsesgossameryguernseyscytolysesdynastieshaplesslyplaylistsautolysesslidewaysspillwayspyrostatssymbiontsstylisersandesytesgooeynesscytosinesstylisingsymbiotespygmyismsgossypolsstylitismsynthpopsaccessarystylizersurostylessyntoniesthymosinsstowawayssurroyalssensatelysplashilyepistylespylorusesmissilerysulfinylsrhymelesslipolysiskoumyssesdyscrasicstaysailsmyoscopeskeystoneslychnisesagelesslypussytoesnimbynesssashayingpapyrusescalisayasdyslexiasdyslexicszymolysesecdysiastspagyricsstypsisessyndromeswitlesslytoadyismsflyspecksosseouslypythonessdialysersdoomsdaysmesophylsskyboardsbackstaysklystronssassywoodsulfurylsyeasayersshipyardsheadstaysyeastiestpyranosesossifyingspinoselydisarrayspaduasoysbiassedlyspinositypolypusesyeastlessdysphasicsyneresessporocystsexlesslylobbyismssynergiaslobbyistssonobuoysostensorysynergidsdyspnoeassynergiessyrupiestpussycatsstylelessyahooismssysadminsoldstylessymphysesdystaxiaspolysomesmystagogshyoscinesmateynessspymastersynesisesviscouslyprostylessyngamiesskylightsdecaylesswaspishlytypecaseshydropsessyngassesoystererssymposiacdomesdaysdystociassycaminesdystoniassycamorescryostatsmisstyleddystopiasmisstylessystemicshouseboyscynicismssycomoressynizesessissynessaneurysmsgypsydomsoverfussynonstylesdyspepsiacopydeskshydroskisgypsyismshydrosolshomolysescynosureshomolysislyricisesforestaysasynapsescronyismssternwaysasynapsislyricismsfissilitydopeynessroyalismsmislayersskywritesdiaphysesboyarismsnonsystemsquashilyapophysissyneresisankylosesunassayedbusyworksfogeyismssynonymesasphyxiesswaybackszymolysispsychoseslissomelyassumablyeyelashesladyshipssottishlymydriasesgaynessessynizesisisobutylsmisassayssyllabicssynoicouslangsynesputtylessstrongylsyoungnesssickishlysyllabismbodysuitssynapsidsberrylesssynapsinglysosomalsyllablespostsyncslysosomesdandyismsyeshivahslysozymesspousallysuccinylsgyrostatssyllabubspyrolysesjackstayspsylliumssessilitysyllepsesmaybusheseyeshineseyesightsdryasdusthokeynessnystatinseyestalksstingrayseyestonessyllepsiseyewashescytastersstatocystdrynessespassinglyyestreensdynamistschlamyseswrynessescytolysisnitrosylshomestayscalypsoesmyoblastsunfussilyfeynesseshygieistsmissayingsukiyakisamethystsbirdseyesassayableecdysonessynclinescageynessskiascopypyrosisestyrosinesidyllistsmistrystspyrosomesptyalisesgossypineloyalnesssourishlycytosomesgreylistshobbyismshobbylessstayawayssyntoninsgipsydomssyntonisesoakawaysphysaliasinsulsitydyschroashoneylesshylicismsbostryxessyntonousphysetershylicistsoryzopsisscybalousmissinglydemyshipspaysagiststylopisepussy's-pawassertoryremissorypussy-pawsspyplanessyndetonssymitaressyphiliseatmolysesnimbyismssurveyalsatmolysisstrayingsdyslaliassubmisslysystemisedyslogiesundersaysphysicismdysmeliaschuprassyspoonwaysitsy-bitsyspagyristpyralisesbullyismsduskishlysymplocusyardgrasspsychismsesemplasywashawayssynechiasdysodilesanecdysespsychistshissinglysyneciousanecdysispseudemysdysodylesgossypiumdesyatinsonychosispyramisessynagropspolyposessensorilypolyposissouthsaysshowyardscorylusessynecticshypocistssynapsidaassay-markmyadestesscolytidssymphilespartyismsdayshellssaltishlysynergisepolysemespsychogasbusinessysyssitiaswesleyismcross-eyeddysthesiasymplastssymplocesdysdercuspuppyismssavoyardssybotismsoverswayssymposialsunlesslyoystrigespsychoidsboobyismssyngraphslypressinponyskinscyamopsisentryismswassailryentryistsskyscapespyritisesaspersorydytiscidsclayinesssisyridaebellylesssymptosessynodsmansealyhamssymptosissynodsmensaleyardsroyalisesurocystiscaddyssessynoecisecoystrelsessayettecoystrilsdiospyrossynoecismpsithyrusnyssaceaeasystolesasystoliclayshaftslaystallsoncolysesoncolysisdiapyesesdiapyesisdaisy-bushsynezesissciosophymersalylsmisarrayscullyismsstachysesdaisybushgay-lussacswaylingschrysemysdissemblytayassuidsubstylarsynapheaspresbytesmerycismssubstylespyroliseshorsewaysyersiniassynaptasepeyotismspeyotistssynoptistsynopticshoistwaysstachyosemassymorestoryingsdyingnessgytrashesplatysmassyllabiseslaisterytyrannesssyllogisejurymastswaygoosessynteniesdynamisesstictomyshypesterssylphidescytisinesplaybusesisocrymessatyriskssmallboysdiastylessylphiestbogeyismsdimissorytsaritsynyouthlesssylvanersemphlysesemphlysisspunyarnssynchysessynchysiswaywisersdowdyismsichthysesassayingspyropuseshypinoseshypinosisraylesslysparsedlysprayiestsprayings
Phrases (34)
shy personyard grassparty bosscase studyadp systemstash awaygas systemstay freshgrass polyboy scoutsnavy crosslazy susansnake eyeslyme grassdry seasongenus gypssun yat-sensea spurrymushy peasdoll's eyeshyssop oilsex symbolabo systembetsy rosscandy kisstax systemerb's palsywood pussyhorsey setsaint's daycgs systemnews storysalad daystsetse fly
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen