9-Letter Words Containing: S,L,A,S,H
(In Any Order)
There are 179 9 letter words,
18 9 letter phrases and
0 9 letter abbr's with
S,L,A,S,H in.
Best Scoring 9 Letter Words With: S,L,A,S,H
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| schmalzes | 9 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| squashily | 9 | 24 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| shmaltzes | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shashlick | 9 | 21 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| squallish | 9 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| backslash | 9 | 20 | nounn | |||||
noun • The punctuation mark \. • Used erroneously in reference to, or in reading out, the ordinary slash, that is, the punctuation mark /. verb • To escape (a metacharacter) by prepending a backslash that serves as an escape character, thereby forming an escape sequence. | ||||||||
| washbowls | 9 | 20 | nounn | |||||
noun • a bathroom sink that is permanently installed and connected to a water supply and drainpipe; where you can wash your hands and face • a basin for washing the hands | ||||||||
| waspishly | 9 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| shashliks | 9 | 19 | nounn | |||||
noun • A form of shish kebab, originally made of marinated lamb meat. | ||||||||
| skaldship | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (179)
establishshamelessheartlesssplashinghourglassfaithlessnewsflashthanklessshapelesschrysalismatchlesshalitosisseneschaldeathlessaeschylusflashiestbackslashcharmlessslavishlyalmshouseshadelessshashlickshoelacesshashlikslithiaseseschewalsskaldshipphysicalslavishestbushlandsthalassicloathnessflagshipsshoptalkswheatlessplanishesalehousesshacklersabolishesshadblowsthallusesnathelessshadfliesseashellsholdfastshaplesslyeschalotshalitoseshalitusescoalshedsshinleafsflashgunssplashersflashingssplashiersplashilyslashingschartlessphallismsphallistsgoulashesashplantsshiploadsphallusesscholiastlavisherspushballsshalloonsheadsailsalcahestswashbowlsshealingsshearlegshandlistssquallishselfhealssulphatesshetlandssablefishwaspishlyfishmealsgaslightspashalicsfishtailspashaliksalkahestschalliseschiliasmsasphodelschasubleschiliastssquashilyeyelashesladyshipshalakistsranchlesslangshansschmalzesunleashesshigellasmarshallslithiasisshmaltzesshillalaschlamysesearlshipschloasmasshoaliestwashablessallowishklatschesbasophilsshellacksheathlessplashiesthospitalsslapheadssphacelusoutlashesslapshotsphysaliasslashfestshauchlessnailfishsplatchessmashablehigh-classchainlessscaldfishscaldshipshawlingsshawllesshailshotswashballspharsalusfishballswrathlessshiraleesreachlessshrapnelssinhalesehavenlessbushwalkssandhillsdayshellssaltishlywashlandsphaseolusmailshotsmashlochshaloseresdishableschapelesshartlessetaplashesshedloadsdeishealsschlagersstartlishsealyhamsmasoolahslayshaftsphaselessclanshipsstanchelsrhipsalisthessaliachamisalsteachlessabashlessshoalingsshoalnessshoalwisechrismalsclarsachsplashingsblashiestclashingsshaftlessPhrases (18)
small shipfrans halssilver ashfish scalestar shellshot glassodd hasselbath saltssisal hempslave shiplhasa apsomohs scalesalt marshshop classhand glasssolar dishallis shadshort sale
