9-Letter Words Containing: M,E,I,K
(In Any Order)
There are 195 9 letter words,
29 9 letter phrases and
0 9 letter abbr's with
M,E,I,K in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
kamikazes | 9 | 28 | nounn | |||||
noun • a fighter plane used for suicide missions by Japanese pilots in World War II • a pilot trained and willing to cause a suicidal crash | ||||||||
quicklime | 9 | 26 | nounn | |||||
noun • a white crystalline oxide used in the production of calcium hydroxide | ||||||||
klezmorim | 9 | 26 | nounn | |||||
noun • A Jewish folk musician. • A type of popular Jewish folk music especially associated with Ashkenazi cultures. | ||||||||
mafficked | 9 | 24 | verbv | |||||
Valid word for Scrabble US
| ||||||||
mafficker | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
milkshake | 9 | 22 | verb, nounv, n | |||||
noun • frothy drink of milk and flavoring and sometimes fruit or ice cream | ||||||||
sheikhdom | 9 | 22 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
miskicked | 9 | 22 | verbv | |||||
verb • To kick incorrectly or badly. | ||||||||
midweekly | 9 | 22 | adjectiveadj | |||||
adjective satellite • occurring during the middle of the week | ||||||||
makeshift | 9 | 21 | adjectiveadj | |||||
noun • something contrived to meet an urgent need or emergency adjective satellite • done or made using whatever is available | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (195)
marketingmotorbikefilmmakermackenziekilometernicknamedmilwaukeemilkshakemakeshiftkilometreleukaemiadisembarksailmakerdreamlikerainmakerkimberleymonkeyingwinemakermerrimackkingmakerquicklimehumanlikequakerismberkeliummilkinessmockeriesmisspokenmurkinesswomanlikemensheviksmokelikeketonemiamouselikemaplelikemonokineschemokinenicknamesbemockingminibikermonickersskimpiestmosaickedmonkeyishirksomelymavericksremarkingflamelikekairomonemimickersmisreckonlimekilnslimericksantismokemarshlikemismarkeddemarkinglemurlikebiomarkerkamacitesgnomelikeforemilksmispickelklezmorimnicknamerkamikazeskoumissesselamlikssheikhdomovermilksbrooklimeemboskingleukemiasleukemicscamellikeleukemoiddiemakersmalarkiesminibikeskinswomenmoleskinsclumplikeskimobiletumorlikelemonlikemaffickedmisspeaksmaffickermonkeriesbesmokingmetallikekirmessesembankingkilomolesmisstrikemiskickedembarkingmanlikelymistakerstimeworkstidemarksmarchlikekaiserdomsmirkiestkaiserismgimmickedmuskinessmouthlikeicemakerssemitruckmislikerskakiemonssemiworksmiscookedsicklemiasicklemickinematicketamineswigmakerssheikdomsmilkshedsmilkweedswomenkindmidweeklymillcakeskalsominesmokinesstokenismskissimmeekingdomedklephtismskrimmagemickeyingmovieokescreamlikemirkinessmockeringalkalemiaimpocketstricksomeunskimmedockerismsglumelikeminibreakumbel-likekrameriasmeekeningplumelikekonimetermerimakesmonkeyismturkmeniasmickeredmusickersmiskennedrampickedmiskeyingmuckeringmuckerishjockeyismkermesitemuckinessthumblikemisleekedmisleekesmimmickedspikemossmousekinsdismaskedsitkamersunmanlikestormlikecomet-likesicklemanmaple-likesicklemenminnickedmonoskiernymphlikebreaktimeminnockedmilk-vetchmisluckedmilk-whitesmocklikephenakismquickbeamketoximesjokesmithmetestickiglishmekmaniclikejimhickeychemickedfiremarksmauve-pinkPhrases (29)
film makermake noisemilk shakewine makermilk yieldlake ilmenmax aitkenmail clerktimur lenklake urmiamike tysonwhole milkski jumperjunk e-mailking jamesskimp overspike mikespike mossmilk addertime clockmilk rivermilk snakeclock timepeking manyukon timekate smithdried milkquick timeeskimo dog