9-Letter Words Containing: K,H,I,M
(In Any Order)
There are 43 9 letter words,
9 9 letter phrases and
0 9 letter abbr's with
K,H,I,M in.
Best Scoring 9 Letter Words With: K,H,I,M
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
mawkishly | 9 | 24 | adverb, adjectiveadv, adj | |||||
adverb • in a mawkish and emotional manner | ||||||||
chipmucks | 9 | 24 | ||||||
Valid word for Scrabble US
| ||||||||
milkshake | 9 | 22 | verb, nounv, n | |||||
noun • frothy drink of milk and flavoring and sometimes fruit or ice cream | ||||||||
sheikhdom | 9 | 22 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
chipmunks | 9 | 22 | nounn | |||||
noun • a burrowing ground squirrel of western America and Asia; has cheek pouches and a light and dark stripe running down the body | ||||||||
makeshift | 9 | 21 | adjectiveadj | |||||
noun • something contrived to meet an urgent need or emergency adjective satellite • done or made using whatever is available | ||||||||
monkeyish | 9 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
monkishly | 9 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
birthmark | 9 | 20 | nounn | |||||
noun • a blemish on the skin that is formed before birth | ||||||||
locksmith | 9 | 20 | nounn | |||||
noun • someone who makes or repairs locks | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (43)
birthmarkhumankindlocksmithmilkshakemakeshifthumanlikehaymakingmenshevikmawkishlychemokinemonkeyishmarshlikesheikhdomchipmuckschipmunksmunchkinskaddishimmonkishlythumbkinsmarchlikemouthlikemisthinksmahlsticksheikdomsmilkshedsmutchkinsklephtismchurnmilkhickymalsmuckerishthumblikejacksmithnymphlikemilk-vetchmilk-whitechimarikophenakismminshukusjokesmithiglishmekjimhickeychemickedskiamachyPhrases (9)
milk shakemarch kingslim thickwhole milkmarsh pinkmilk punchmilk tooththomas kidkate smith