9-Letter Words Containing: I,T,E,N,C,Y
(In Any Order)
There are 62 9 letter words,
3 9 letter phrases and
0 9 letter abbr's with
I,T,E,N,C,Y in.
Best Scoring 9 Letter Words With: I,T,E,N,C,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| enzymatic | 9 | 25 | adverb, adjectiveadv, adj | |||||
adjective • of or relating to or produced by an enzyme | ||||||||
| convexity | 9 | 24 | nounn | |||||
noun • the property possessed by a convex shape • a shape that curves or bulges outward | ||||||||
| citizenry | 9 | 23 | nounn | |||||
noun • the body of citizens of a state or country | ||||||||
| citizenly | 9 | 23 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| inexactly | 9 | 21 | adverb, adjectiveadv, adj | |||||
adverb • in an imprecise manner | ||||||||
| nymphetic | 9 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| neophytic | 9 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| fecundity | 9 | 18 | nounn | |||||
noun • the intellectual productivity of a creative imagination • the state of being fertile; capable of producing offspring • the quality of something that causes or assists healthy growth | ||||||||
| impotency | 9 | 18 | nounn | |||||
noun • the quality of lacking strength or power; being weak and feeble • an inability (usually of the male animal) to copulate | ||||||||
| metonymic | 9 | 18 | adjectiveadj | |||||
adjective satellite • using the name of one thing for that of another with which it is closely associated | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (62)
certainlycertaintynecessitysinceritysyntheticsyndicateobscenityethnicitycitizenryhesitancyintercitymendacityfecundityimpotencyinexactlyancientlyenzymaticstridencymendicitycabinetrycycloniteethylenicrenitencyreticencyneophyticcysteinescytosinesmetonymicencystingitineracyintestacysentiencythylacinesyncreticasyndeticendocyticcysteinicnympheticcitizenlyinsectaryconvexitycytidinesancientrygenotypiccytokinesonychitesmetycainesynecticspenitencyfinicketynyctimeneincretorycynegeticcystideanhercyniteceylonitedictyogensyntecticceylaniteexcitancycytisinescytopeniaPhrases (3)
queen citysticky endinner city
