9-Letter Words Containing: I,H,H,E
(In Any Order)
There are 164 9 letter words,
17 9 letter phrases and
0 9 letter abbr's with
I,H,H,E in.
Best Scoring 9 Letter Words With: I,H,H,E
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| rhythmize | 9 | 29 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| hitchhike | 9 | 24 | verbv | |||||
verb • travel by getting free rides from motorists | ||||||||
| hexastich | 9 | 24 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| whichever | 9 | 23 | adjectiveadj | |||||
pronoun • (interrogative) Which ever; emphatic form of 'which'. • Irrespective of the one(s) that; no matter which one(s). • Any or either one(s) that; the one(s) that. • Any or either one(s). • According to or depending upon which one(s). | ||||||||
| everwhich | 9 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
| thickhead | 9 | 22 | nounn | |||||
noun • Australian and southeastern Asian birds with a melodious whistling call | ||||||||
| sheikhdom | 9 | 22 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
| chiefship | 9 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| highflyer | 9 | 22 | nounn | |||||
noun • a person of great ability and ambition | ||||||||
| hyphemias | 9 | 22 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (164)
whichevercherishedhealthierhierarchywhitefishhampshireshoeshineshellfishhitchhikeheadlightwhitehallwhitewashshipshapehealthilyzechariahwhiteheadhellishlythighbonethickheadthirtiethhorsewhiphorsehidetherewiththreshingeightiethwherewithhighflierhorsehaircherishersheathinghalophileinsheatheinsheathshaughtierrehashinghemistichshanachieheehawinghiphuggerhippieishyeshivothhelminthsheightensheirshipsrhachidesunhitcheshexastichhighrisesthithertothatchierchichiesthemophileheathlikesheikhdomrheophilechurchierhemstitchheadshipschiefshiprhythmizethaneshipcherisheshogfisheshighflyercheshiresschlemihleverwhichhuisacheshierarchshashishesshlemiehlphthaleinyeshivahsphosphinedahabiehsthiophenethiophensphosphideshillelahheathbirdheightismphosphitechelashipsheatfishhyphemiashomophilehypheningnowhitherhoydenishhagfishesheathiestrhachisesunhitchedhennishlychinchierhighlifeshushabiedhushabiesschechitarhaphideshusheringphilohelathetchinghighveldsratherishhip-lengthtephillahhiplengthpeishwahshigh-gradeheliothishigh-keyedhigh-levelwheughinghemihedryhigh-powerthearchicrhythmiseushershiphigh-speedhigh-tonedhigh-yieldsheathiersheuchingphilhorsehealthismheroshipsshriechedsheughingshriecheshindheadsshechitahshechitaschecheniawhitheredthegitherzephaniahhomebirthhorsefishhardiheadhighwaterwheechinghitchiestshritchedshritcheshitheringhoidenishone-eighthhollerithcholelithdahabiyehshehitahswhite-shoewheeshinghindemithsuperhighwhitelashhypheniseshochetimhigheringhyphenismheadchairhyphenizeichthysesPhrases (17)
high styleto the hiltwhite heathired helpleigh hunthigh tablehigh vowelhigh waterwhite hopehired handill healthhigher lawhit the haydeath wishfresh fishhigh heelshigh horse
