9-Letter Words Containing: I,C,E,T,Y
(In Any Order)
There are 165 9 letter words,
9 9 letter phrases and
0 9 letter abbr's with
I,C,E,T,Y in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
mythicize | 9 | 28 | verbv | |||||
verb • interpret as a myth or in terms of mythology • make into a myth | ||||||||
syzygetic | 9 | 27 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
objectify | 9 | 26 | verbv | |||||
verb • make external or objective, or give reality to • make impersonal or present as an object | ||||||||
enzymatic | 9 | 25 | adverb, adjectiveadv, adj | |||||
adjective • of or relating to or produced by an enzyme | ||||||||
convexity | 9 | 24 | nounn | |||||
noun • the property possessed by a convex shape • a shape that curves or bulges outward | ||||||||
citizenry | 9 | 23 | nounn | |||||
noun • the body of citizens of a state or country | ||||||||
excitably | 9 | 23 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
sequacity | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
citizenly | 9 | 23 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
excitedly | 9 | 22 | adverbadv | |||||
adverb • with excitement; in an excited manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (165)
certainlycelebritychemistryspecialtycertaintyhypocritenecessitysinceritysyntheticsyndicatedirectoryobscenityexcitedlyhystericsethicallyethnicitycitizenryprecocityobjectifycredulityelectrifyhesitancyintercitysymmetricmendacitydyspepticfecundityimpotencycityscapeinexactlyembryoticdyslecticancientlyenzymaticstridencyfebricitystitcherymendicitydecertifycabinetryhaecceitydeclivitycyclonitelipocytesethylenicadipocyterenitencytelicallycryolitesreticencycopyeditscoevalityneophyticrecertifyfictivelyerythemiceurythmiccysteinestactilelygeophyticepicotylsexcitablymicrocytelipectomycytosinesplicatelycostivelyciliatelymetonymicsequacitywyliecoathemolyticencystingitineracysupercityintestacysentiencyedictallyecdysiastsketchilybiacetylsmythicizeductilelypredacitytricycleseucalyptithylacinemysticetesystemicsaliteracysyncreticasyndeticsectilitysyzygeticendocyticepiphyticeurytopiccysteinicdiacetylsnympheticcitizenlymythopeicsylleptictachyliteinsectaryconvexitycytidinesancientrysepticitygenotypicphyleticscytokinesacetyliseacetylizechemitypechemitypyverticitykvetchilyclericityproceritymysticetionychitesdicasterymetycainepresbyticmythicisefibrocytesynecticspenitencymethysticiridocytetricycledtricyclerdystecticfinicketychalybitenyctimeneincretorydystheticrecyclistcynegeticglyceritepepticitysciophytediapyeticcystideandicky-seatmelicytushercyniteclitocybeceyloniteacetylidedictyogenricketilysyntecticceylaniteexcitancycity-statecytisinescytopeniaarchitypesericterywitchettymeiocytesichthysesPhrases (9)
direct dyeitchy feetqueen citywrite copytipsy cakedodge citysticky endinner cityaztec lily