Dictionary Only:
Profanity Off:

9-Letter Words Containing: H,A,G,E

 (In Any Order)
There are 410 9 letter words, 69 9 letter phrases and 0 9 letter abbr's with H,A,G,E in.

Best Scoring 9 Letter Words With: H,A,G,E

Expand?WordSave?LengthUsagePointsType
xylophage9
25 nounn
Valid word for Scrabble US
megahertz9
24 nounn
noun

• one million periods per second

exchanged9
23 verbv
adjective satellite

• changed for (replaced by) something different

gazehound9
23 nounn
Valid word for Scrabble US
gigahertz9
23 nounn
noun

• 1,000,000,000 periods per second

hypergamy9
23 nounn
noun

• Act or practice of seeking a spouse of higher socioeconomic status or caste status than oneself.

exchanger9
22 nounn
noun

• one whose business is to exchange the money of one country for that of another country

exchanges9
22 verb, noun, adjectivev, n, adj
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

hexagrams9
22 nounn
noun

• a regular polygon formed by extending each of the sides of a regular hexagon to form two equilateral triangles

hexagonal9
20 adjectiveadj
adjective

• having six sides or divided into hexagons

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 9 Letter Words

Words (410)
happeningbreathingchallengechampagnesearchingnightmaregatheringorphanagegodfatherslaughterspaghettidischargehamburgerexchangedpreachinggeographytelegraphhammeringachievinghemingwayunchangedarchangelheadlighthermitagegonorrheapigheadedenhancinggorbachevmegaphoneanchoragelethargiclaughablegilgameshesophagusearthlinganguishedsurchargeaegisthusbeheadingrechargedhexagonalshogunateharbingerstagehandhankeringhardeninggarnisherharanguedphalangesshrinkagehydrangeasagebrushangelfishgaucheriegrapeshotlogorrheamegahertzbigheadeddiaghilevcheongsamalleghenyrechargergearshiftshaggiesthypallagereheatingshearlingwreathinggazehoundchagrinedfightablenaughtierexchangergigahertznightweargatehouseghastliereightballmeshugaassheathingforgatherhagriddenideographrehearingharboragemishegaasphagocytechangefulserigraphgarnishedgearwheelanguishesgarnishesphagosomeheritagesxylophagerehabbingreshapinghaughtiersiphonageprophagesweighablerehashingupgathersgalumphedgoatherdsharangueschantagesdetachinglatheringbleachingnarghileshabergeonchalcogenupheavingoesophagiepigraphyheraldingbreachingbeachgoerfatheringheehawinghogsheadsshortagesthreadinggreenwashrechargespathogeneshigellaehangoversexchangeshasteningharanguerteachingshearthrugchelatingmegillahsdaughtersgnathiteshamperingphagedenaapothegmsgatecrashgearheadsoverhangsbaghousesheadgatesheadgearsethogramsshagreenslongheadsgatherersregatherspleachingbeshamingnaugahydenaughtieslightfacegalabiehsreshavingechogramshagridersashleringmegadeathgraphemesgraphemichemialgiarehangingcachetingshavelingnaethingsheliogramgoulasheschangeupsoutchargeencashinggraphiteslightwaveeggheadedcoheadingclaughtedhalogetonepigraphsshealingsmegathereshearingsscraighedshearlegsheptagonsmischargephilabegsbarghestshyalogensupheapingchigetaisingathersnargilehswharfagesgasholderenchasinggashousessafelightgreenheadunchargeshardedgesfraughtedoleographdeadlightrewashingenhaloinghalteringchasseinggheraoingrepechagegarnisheehectogrampharyngesphreakingprechargehogmenaysdoughfacedraughtedgiltheadsmegalithsdoghangedhogwashesapophygesrechangedunchargedrechangesepiphragmthreapinghangfiresroughagesthreatinghangnestsshigellaspathogenspathogenygeophagiaergographgarfisheshomepageshexagramshelotageskasheringlaughlinenephogramhanselinglaughterscoliphageharkeningglidepathanthemingathelingshagbushesrachetingthirlagesmeshuggahhagfisheslarghettophalangerhektogramhypergamylithargestheophagyphenogamsheadguardhatteringchummageshag-riddenlengthmangalabeahsherkogamybagwashestephigramsight-readextraughtgauchescoanhungredmegachilelychgatestragelaphsightreadweighageshigh-gradegalumphergramashescheatingsheadringsareachingmoygashelsheadingsgomphrenaeggwasheswasheringgate-crashegg-shapedcerographaerographheptaglotenchafinggamahuchegramochesechographhaveringsenchargedenchargesgamarucheflaughtedflaughterhealinglymycophagehypogaealhypogaeanrightablehypogaeumviewgraphghastnessgreenhandragwheelsthylogalemageshipsgallabeahharteningphillabegfraughterlichgatesaerophagygallabiehchargemangabnashesberghaansfig-shapedspanghewspaughtiereidographpigwashesschlagersbag-shapedsightableangashorephenergansegholateruggelachdraughterangelhoodgray-whitehighwatersagathiesdegarnisheaglehawkembathingahungeredfather-godherpangiahelwingiaxerophagyeightsmanagastachepagehoodsmegaphyllgraunchedscraughedgrauncherhierogramheartlingwaghaltergraunchesshroffageguarishedguarisheshercogamyiphigeniaknightageunheadingunhealingberthagesgravelishlight-yeardanelaghsendophagynightgeargytrashesleachingspergunnahlaughiestnegroheadarchimagelaughsomesetophagaatheisingcreophagyphaenogambedashingatheizingnephralgyfughettashagbuteerunhearinghemigalushagbutterheadbangshospitageatheologychargefulhemagoguepeshmergaenarchingshaggable
Phrases (69)
laugh linewhole galewhite flaghome rangehang glidelong beachogden nashreal thingglide pathguinea henlight beamgenus rheachess gamegive chasehop gardengenus hylaget a whiffsea changepesh mergamatch gamesage brushhigh tablehigh waterrange hoodlever hangdouche bagdepth gageshell gamehog badgerhome guardhog peanutwheat germnear thinggrey whaleghedda waxhugh capetbath glovesex changehour anglechen n. yangthird gearcare a hangdehong daihorse gramhigher lawoil changewhite sagethe gambiahave younggray whalerear lighteight ballgenus hoyajames hogggive a hanggive a hoothalf eaglegas heatergas helmetgas holdernight gamekeogh planoregon ashgear wheelfresh galegreat hallfish eagleno-hit gamethen again
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen