9-Letter Words Containing: E,Y,E,C
(In Any Order)
There are 193 9 letter words,
30 9 letter phrases and
0 9 letter abbr's with
E,Y,E,C in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
crazyweed | 9 | 27 | nounn | |||||
noun • any of several leguminous plants of western North America causing locoism in livestock | ||||||||
frequency | 9 | 26 | nounn | |||||
noun • the number of occurrences within a given time period • the ratio of the number of observations in a statistical category to the total number of observations • the number of observations in a given statistical category | ||||||||
myxedemic | 9 | 26 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
coenzymes | 9 | 25 | nounn | |||||
noun • a small molecule (not a protein but sometimes a vitamin) essential for the activity of some enzymes | ||||||||
wheyfaced | 9 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lacqueyed | 9 | 24 | ||||||
verb • To attend, wait upon, serve obsequiously. • To toady, play the flunky. | ||||||||
exercycle | 9 | 23 | nounn | |||||
noun • an exercise device resembling a stationary bike | ||||||||
wheyfaces | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
execrably | 9 | 23 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
excitedly | 9 | 22 | adverbadv | |||||
adverb • with excitement; in an excited manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (193)
necessaryemergencyperfectlysecretarypreciselycelebrityfrequencysincerelynecessitymercenarytreacheryecosystemresidencyarchetypeexcitedlydecidedlyindecencyglycerinearchenemycentenarybellyacherefectoryacetyleneelectrifyobscenelyhackneyedrelevancypeaceablyleukocytecoherencyhyperemicspeechifyleucocytemycenaeanhydrocelepelecypodappetencydecayabledecennarydecertifyglyceridehaecceitycybernatepolychetehemicycleacetylateclergymenethylenicesuriencyabeyancesvehemencywheyfacedrenitencyundecayedrespecifywelcomelycerotypescoenzymesreticencysyngeneictypefacescoynessescypressesrecertifysecretorycanyoneererythemicosteocytecysteinesconveyersteacherlyheadacheyexcretoryencryptedpericycleentelechydecadencymegacyclelycopenesgynaeceumlacqueyedcuneatelysentiencyelectuaryexercycleexocytosewheyfacesdecretorytelescopycoenocytecymbaleereucaryotecorypheesinherencyembraceryexecrablycurtseyeddecryptedcymogenescrazyweedgeneralcyrecyclersdecaylessmysticetetypecasessergeancyexecutoryreconveyscryometerhemocytesmyelocyteeyeblacksredolencypachytenelectotypecybercafeamebocytecystocelecrenatelycyclerieseyepiecescleareyedwatcheyesrecreancyhypercubemyxedemicepicyclesecdysonescageynessclementlyacetyliseacetylizewycherleychemitypetemulencygreywackemyrtaceaesprecheryycleepingscythementyphaceaeflyscreendaycentrerecluselyanecdysesmetycaineaepycerospenitencyoomycetesbleacherycoryphenedecastyleremanencycross-eyedrecyclatenyctimeneexecutaryyellochedcynegeticengyscopeglyceriteglycerolecyberpetssynoeceteveterancydejectorysynoecisecherry-redfancy-freecandyweedsynoecizenyssaceaehaemocyteacescencyburleycueeumycetesdeceptorycheveryeshercyniteserjeancyclear-eyedceyloneseceyloniteacetylidecoelogyneceylanitefeculencyectophytechimneyedsericteryhydnaceaemeiocytescytometerPhrases (30)
direct dyeitchy feetqueen cityeye doctorspeech dayeye sockethenry lucecoenzyme acoenzyme qlayer cakehoney cakedry cerealevery inchemery rockde quinceyh. j. eysenckbeta decaylife cyclerelay racemercy seatcrazy weedyeast cakeeye cliniceye coloureye musclepublic eyepeace lilymichel neyfrench ryeice hockey